(data stored in ACNUC7421 zone)

EMBL: CP002116.PE400

CP002116.PE400       Location/Qualifiers
FT   CDS_pept        421534..422013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0218381 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79560"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB30"
FT                   /protein_id="ADK79560.1"
FT                   /translation="MKNNNKQNNKEDGENNFKIIERELELSHSFLRVEQFFNPKRIPFE
FT                   FVFTNPFSTTCCYFTIKISSIYFKDLVSDSEELMFTKIKSENNQILVFQSTKEKKIHKN
FT                   EPVNFKAYAILRSDSFYRGTFNKESAIKDQRHWMQLSIFDDIGEISCRIVREISE"
     atgaaaaata ataataaaca aaataataaa gaagatggtg aaaacaattt taagattatt        60
     gagagggagt tagaattaag tcatagtttt ctaagggttg aacaattttt taatccaaaa       120
     agaataccat ttgaattcgt ttttacaaat ccgttttcta ccacttgttg ttatttcacg       180
     attaagatat caagtattta ctttaaagat ttagtttcag attcagagga attaatgttt       240
     acaaaaatta aaagtgaaaa taatcaaata ttggtatttc aaagtacgaa agagaaaaag       300
     attcataaga atgagcctgt aaattttaaa gcatatgcaa tcttaagaag tgattcattt       360
     tatagaggta cttttaataa agaatctgca ataaaagatc aaagacattg gatgcagtta       420
     tcaatatttg atgatattgg agaaatctcg tgtagaattg taagagaaat atctgaataa       480
//

If you have problems or comments...

PBIL Back to PBIL home page