(data stored in ACNUC7421 zone)

EMBL: CP002116.PE408

CP002116.PE408       Location/Qualifiers
FT   CDS_pept        431106..432038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0417"
FT                   /product="protein of unknown function DUF437"
FT                   /note="COGs: COG4405 conserved hypothetical protein;
FT                   InterPro IPR000182:IPR007374; KEGG: cac:CAC1000
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF437; GCN5-related N-acetyltransferase; SPTR:
FT                   Uncharacterized protein, homolog of yhfF B.subtilis; PFAM:
FT                   Acetyltransferase (GNAT) family; ASCH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79568"
FT                   /db_xref="GOA:E1RB38"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB38"
FT                   /protein_id="ADK79568.1"
FT                   /translation="MLKTKQIKNDDVPYELIYLADEDDDQINKYKDTSTFLATMDDEKI
FT                   IGIIGINEINEESTEIVCVAVDEAYQNKRIGTNLIEKAISYSKDKKYKELIIKTGNCGI
FT                   GQLYLYQRCGFRFDSVNKDYMIKNYKNPIYENDIQCFDQIVLKYRIFSEKELTKIIEEY
FT                   WNRFIKKNKEYEKSKYEVWSFGYSENLANKLIGYVKEGKKTGTSSALEMYDIDEKVPEE
FT                   GDISIITYGNGLPGCIIKTEEMRKKKFREITEEEARLEGEGDLSLEYWRNAHEHFFRLE
FT                   YEEQGKKFSEEIPVIFERFKVIYDEDRKI"
     atgcttaaaa ctaagcagat aaaaaatgat gatgttccat atgaattaat ctatcttgca        60
     gatgaagatg atgaccaaat caataaatat aaagatacat caacctttct agcaacaatg       120
     gatgatgaga aaatcatcgg aattatcgga ataaatgaaa taaatgaaga atcaacagaa       180
     attgtatgtg ttgctgtaga tgaagcatat caaaacaagc gaattgggac aaatctaatt       240
     gaaaaagcga tatcatattc gaaagataag aaatataagg aactaataat aaaaacagga       300
     aattgtggaa tagggcagtt atatttgtat caacgctgtg ggtttagatt tgattctgtt       360
     aataaagact atatgataaa aaattataaa aatccaatat atgaaaatga tattcaatgc       420
     tttgatcaga ttgttttgaa atataggata ttttccgaga aagaattaac aaaaataatt       480
     gaagaatatt ggaatagatt tataaagaag aataaagaat atgaaaaatc aaaatatgaa       540
     gtatggtctt ttggatatag tgaaaatctc gctaacaaat tgattggata tgtaaaagaa       600
     ggaaagaaaa ctggaacatc atcagcatta gaaatgtatg atattgatga aaaagttcct       660
     gaagaaggtg atatatcgat aataacatac ggaaatggat tacctggatg tataataaaa       720
     acagaagaga tgcggaagaa gaaatttaga gaaattacag aagaagaggc aagattagag       780
     ggtgaaggag atctttcatt ggaatattgg agaaatgctc atgagcattt ctttcgatta       840
     gaatatgaag agcaaggaaa aaaattttca gaagaaattc ctgtgatatt tgagagattt       900
     aaagtgatat acgatgagga cagaaaaata tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page