(data stored in ACNUC7421 zone)

EMBL: CP002116.PE41

CP002116.PE41        Location/Qualifiers
FT   CDS_pept        complement(41819..42910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0041"
FT                   /product="Patatin"
FT                   /note="COGs: COG3621 Patatin; InterPro IPR002641; KEGG:
FT                   cyc:PCC7424_4648 patatin; PFAM: Patatin; SPTR: Patatin
FT                   family protein; PFAM: Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79201"
FT                   /db_xref="GOA:E1R6R9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R9"
FT                   /protein_id="ADK79201.1"
FT                   /translation="MNHINSLWYSRLVPGRTIRILSVDGGGIRGYLAALILEEIEKKRT
FT                   EIGRKKPFCRCFDMMAGTSTGSLISLGLAVPQSRKLPTDSPEESSKKTPLMPRLINILS
FT                   TNAHPKYNAAEIARLYREKGTEIFPRYIFKQLNTVRQAFVEKYDAGNFDRVLEDIFGDL
FT                   TLRDALGRVLITSYDTLSARPIIMKNLPGEENFYMKDAARGSSAAPSYFSPVEVTGLDS
FT                   NAPFCLVDGGVFANNPAMCAYVEARRLFPLARKFFILSLGSGQLEQRLSYKQVKSWGYV
FT                   EWVLPQNNVPLFGMMSTGQNKCVDYQLNHLPGVTYIRFNPLLNGCSEEMDDAGAKNMEC
FT                   LEAVAKRTIEGNRRLIDLIARFL"
     atgaatcaca tcaattcact ctggtatagc cgactggtgc ctggaagaac catccgcatc        60
     ctatccgtag acggaggagg aatacgtggc tatcttgctg cactcattct cgaagagatt       120
     gagaaaaaac ggaccgaaat aggaagaaaa aaaccatttt gccgctgctt tgatatgatg       180
     gcgggaacaa gcaccggcag cctcataagc ctcggcctgg ccgttccaca atcgaggaaa       240
     ttacccacag attctcccga agaaagctcg aaaaaaacac cgcttatgcc caggcttatt       300
     aacattttat ccacaaacgc tcaccctaaa tacaacgccg cagagatcgc acgcttatac       360
     cgagaaaaag gaacagagat ttttccacga tatatcttca aacagttgaa tacggttcgc       420
     caagcctttg tggaaaagta tgatgcagga aatttcgatc gtgtgcttga agatattttc       480
     ggcgacctta ccctccggga tgctttggga agggttctga taacaagcta cgatacccta       540
     tcagcccgtc ccattatcat gaaaaatctt ccgggagaag aaaatttcta catgaaggat       600
     gccgcaaggg gatcctcagc cgcccctagc tatttttcac cggtcgaggt taccggattg       660
     gacagtaatg ctccattctg cctcgtcgac ggcggggtct ttgccaacaa tccggcaatg       720
     tgcgcctatg tggaggcccg caggcttttt ccccttgcca gaaagttttt catcctttcc       780
     ctcggctctg gacagctgga acagcgattg agctataaac aggtcaaaag ctggggctat       840
     gtggagtggg tccttccgca aaacaatgtt ccactttttg gaatgatgag cacaggacaa       900
     aataagtgcg ttgattatca gctgaaccat ctccccggag taacatatat ccgctttaat       960
     cctttgctta acggctgtag tgaggagatg gatgacgcag gagcaaaaaa catggagtgt      1020
     ctcgaagcgg tggcaaaacg cacgatcgag ggaaacagaa ggcttatcga tctgatagcc      1080
     aggtttcttt ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page