(data stored in ACNUC7421 zone)

EMBL: CP002116.PE414

CP002116.PE414       Location/Qualifiers
FT   CDS_pept        438049..438990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0425"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611:IPR002173; KEGG: amt:Amet_0892
FT                   ribokinase-like domain-containing protein; PFAM: PfkB
FT                   domain protein; SPTR: PfkB domain protein; PFAM: pfkB
FT                   family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79574"
FT                   /db_xref="GOA:E1RB44"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB44"
FT                   /protein_id="ADK79574.1"
FT                   /translation="MGARSVKNILVWGEPMFGFYPIDNPMIEKCNTLSMTWGGDASNFA
FT                   IGVARLDHHSVFFTGLGTEPFGDGFIDLWMKNGVDVSQVVRDPSRRTGFYFVSFINGKH
FT                   NLTYYRENSAATAIQFAQLDQQVLKESAVFHFTGTGLGMGSAARTLCRQIIDAKKGSDC
FT                   IISFDVNYRTLQWNDPILAEREISNAIASGVTHLDITDDEMFALGWGTDLDALIRRFPT
FT                   LEVIAYKQGPKGVTIKTRGSQFDSPAFLVKVKDTVGAGDSFDVGFIISLLEGKSLEEAA
FT                   RIGNATGGLTCTGLGPISSSPTRKELDEFLAT"
     atgggggcac gaagcgtgaa aaatatactt gtatggggag agccgatgtt tggattctat        60
     cccattgata atcctatgat cgaaaagtgc aacactctga gcatgacttg ggggggggat       120
     gcttccaatt tcgccatcgg agttgctagg ttagaccatc attcggtttt ctttacagga       180
     cttggcactg aaccattcgg agatggattt atcgatcttt ggatgaaaaa cggagtggat       240
     gtttcccaag tcgtccgtga tccttcccgg cggactggct tctactttgt atcattcatc       300
     aatggcaagc ataacctgac ttactatcgg gaaaattcgg cagcaacagc catccaattt       360
     gcccaactag atcagcaagt ccttaaagag agcgccgttt tccacttcac cggtactggt       420
     cttggtatgg ggagtgctgc tagaacactc tgccgacaaa tcatagacgc aaagaaaggg       480
     agtgattgta tcatctcctt tgatgtgaat tatcgcacat tacagtggaa cgaccccatt       540
     ttagcggaac gggaaatatc gaatgcgatt gcttcaggtg tgacccattt ggatatcacc       600
     gatgacgaga tgtttgcatt ggggtgggga accgatcttg atgccttgat cagacgtttt       660
     ccgacacttg aggtaatagc gtacaagcag ggcccaaagg gcgtaaccat aaaaacccgt       720
     gggagccaat tcgactcacc ggcattcttg gtaaaggtga aggacacagt tggtgctgga       780
     gacagctttg atgttggatt catcatatca ctcttagaag gaaaaagtct cgaagaagct       840
     gcaagaatcg ggaatgctac gggaggtctc acctgtactg ggctcgggcc aatctcatcg       900
     tcgccaaccc gcaaggagct tgatgaattc ttggcaacat ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page