(data stored in ACNUC7421 zone)

EMBL: CP002116.PE42

CP002116.PE42        Location/Qualifiers
FT   CDS_pept        complement(42907..44283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0042"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: amt:Amet_4230 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: MATE efflux family protein; TIGRFAM: MATE efflux
FT                   family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79202"
FT                   /db_xref="GOA:E1R6S0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S0"
FT                   /protein_id="ADK79202.1"
FT                   /translation="MHVTDQLFGDRSFRKELLRIAVPVALQNLLISSLSVVDTLMIGQL
FT                   GEVEIAAVGLANQLFFLSLLFFFGVSSGASVFIAQFWGKKDIPSIHRTVGFAFSFAGSA
FT                   AILFSLLSLTIPDQILRIFTTDEAVVTVGVEYLRVVGISYLFVAASVLSSVSLRSIEEA
FT                   ATPLRATTASIIANIILNYLLIFGKFGFPQMGVAGAALATTISRCLELIILYHAIFVKK
FT                   NILAAPVRTFFDFNSSFVRRFLKTATPVILNEMAWATGMVVYKIVFARMGTGVIAAMNI
FT                   VDTASNLLFIIFMGTSNACAVMIGKRVGMGKKEEAFTAGRHFIAIGFFFGAVVGLGALL
FT                   LARFIPGLFNVSDQVKLMTARVLRLFPIIFPLKALNIHTVIGIFRAGGDTAFSFFVDLS
FT                   GVWLVGVPLAFLGAFVWELPIHLLFLLLGMEEVCKTIMGLLRFRSRLWVRDITEGEVST
FT                   "
     atgcacgtta ctgatcagct attcggagac cgttccttcc gaaaagagct gcttcgcatt        60
     gccgtccccg ttgcgcttca gaatcttctc atatcaagcc tttcagttgt agataccctt       120
     atgatcggtc agcttggcga ggtggagatt gcagcagtcg gactggcaaa tcaacttttt       180
     ttcctctcac ttctcttctt tttcggggtc tcaagcggcg catcggtctt tatcgcccag       240
     ttctggggaa agaaagatat cccgtcgatt caccgaaccg taggctttgc cttcagtttc       300
     gcaggttctg ccgccatact ctttagtctt ctttctctca ctatccccga ccagatcctc       360
     aggattttta ctaccgacga agcagtcgta acggtcggtg tcgaatactt aagggtggtg       420
     gggataagtt atctttttgt tgcggcaagt gttctatcat cggtaagcct gcgcagtatc       480
     gaagaagcag ctacccctct gcgggcaacg acagcatcga tcatagcaaa tatcatcctc       540
     aattatctcc ttatcttcgg gaagttcggc tttcctcaaa tgggggttgc cggggcagcc       600
     ctggcaacca caatttcacg atgcctggaa ctgatcatcc tctaccatgc aatctttgtc       660
     aaaaagaata tcttggccgc tcccgtccgg accttttttg acttcaacag ctcttttgtc       720
     cgtcgctttc tcaagactgc gaccccggta attctcaatg aaatggcctg ggcaaccggc       780
     atggttgtct acaagatcgt atttgcaaga atgggaaccg gagtaattgc agcaatgaat       840
     atcgttgata ccgcaagcaa tcttcttttt attatcttta tgggaacgag taatgcctgt       900
     gcggtcatga ttggtaagcg ggtcgggatg ggaaagaaag aggaagcatt cacagccgga       960
     aggcatttca ttgcaatagg attctttttc ggagcagtgg taggactcgg agcactcctt      1020
     cttgctcgtt tcattcccgg tcttttcaat gtaagcgacc aggtaaaatt aatgacggca      1080
     cgagttcttc gtcttttccc tattatcttt ccacttaagg cccttaatat tcacaccgtc      1140
     atcggtatct ttagagccgg aggcgacacg gccttcagct tttttgtgga tctttccgga      1200
     gtctggctcg tgggggtgcc ccttgcattt ttgggagcct ttgtatggga actgcctatt      1260
     catctgctct ttttgttgtt gggtatggaa gaagtgtgca aaactatcat gggtcttctt      1320
     cgttttcgaa gcagactttg ggtcagggat attaccgaag gtgaggtatc gacatga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page