(data stored in ACNUC7421 zone)

EMBL: CP002116.PE428

CP002116.PE428       Location/Qualifiers
FT   CDS_pept        454074..454910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0441"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: maq:Maqu_0236
FT                   integrase catalytic subunit; PFAM: Integrase catalytic
FT                   region; SPTR: Integrase catalytic region; PFAM: Integrase
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79588"
FT                   /db_xref="GOA:E1RB58"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB58"
FT                   /protein_id="ADK79588.1"
FT                   /translation="MIDPSDRHLSIARQSELVGVSRSHHYYKKRAPQRADIEEMIKLKE
FT                   LFIKYPFYGYRKQMLELGNESIVSTVKRVRRFMKELGLKALSPKKLTSIPKKEHPVYPY
FT                   LLKGKRIRYPNQVWATDITYLKLETGYVYLVAIMDLYSRKVLSWRISLTMDAEFCCEAL
FT                   KDALRNYGTPAIFNTDQGSQFTSYGFLQILKDEGVEISMDGQGRWRDNIYVERFWRTLK
FT                   YEDIYLKSYESVRELKTGLTRYFRFYNSRRFHQGLDYRTPEEMYISFQEKELKAAA"
     atgattgatc cttctgaccg tcatctctct attgctcggc aaagcgaact ggttggtgta        60
     agtcgttctc accactacta caaaaaacgt gccccacaac gggctgatat agaagaaatg       120
     atcaagctga aagagttgtt tataaagtat ccgttttatg gttaccgtaa acagatgctt       180
     gaactgggca atgaatctat tgtctctacg gtaaaacggg tccgccgttt catgaaagaa       240
     ttgggcctta aagcgctgtc accgaagaaa ttgacatcca tcccgaagaa ggagcatccg       300
     gtttatccat atctgctgaa aggaaagagg atcagatatc ccaatcaggt ctgggcgacc       360
     gatattacct atctgaagct tgaaacagga tatgtttatc tggttgccat tatggatctc       420
     tatagccgta aagttttaag ctggaggatt tcactcacta tggatgcaga gttctgctgt       480
     gaagcgttaa aggacgccct gagaaactat ggcacgcctg cgatcttcaa tacagaccag       540
     ggaagtcagt ttacctccta tggctttctt caaatcctga aagatgaagg tgtagaaatc       600
     agtatggatg gtcagggccg ttggcgggat aatatctatg ttgaacggtt ctggcgaact       660
     ctcaagtatg aagatattta cttgaagtcc tatgaatcag tgcgagaact gaaaaccgga       720
     cttacccggt acttcaggtt ctacaacagc cgaagatttc atcagggcct ggattatagg       780
     actccggaag agatgtatat atcattccag gaaaaggagc ttaaagctgc tgcatag          837
//

If you have problems or comments...

PBIL Back to PBIL home page