(data stored in ACNUC7421 zone)

EMBL: CP002116.PE429

CP002116.PE429       Location/Qualifiers
FT   CDS_pept        455153..455608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_1902 helicase C2; SPTR:
FT                   Transcriptional regulator, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79589"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB59"
FT                   /protein_id="ADK79589.1"
FT                   /translation="MGHGVAIMKGEPLPVQIRSVPIRRQPHAKTTRMWGNLFHKRLFQE
FT                   DGLRGEGFTRDHYKVQNMSSTDIKTATGLVAANKDVGDKLVFTNQSTTISFSCQEIQAT
FT                   DEHLESMGYLIQDFFRNGCRANRDLFAMRLATLVRVIRETINEGVLE"
     atggggcatg gcgttgcaat catgaaaggc gaacctctac ccgttcaaat cagatcggtc        60
     cctatacggc gccaaccaca cgccaaaacc acgaggatgt ggggaaattt gtttcacaaa       120
     cggctctttc aagaggatgg tctccgtggc gaggggttta ccagagatca ctacaaggtg       180
     caaaacatga gcagtacaga cataaaaacc gctaccggtt tggtagcggc aaataaggat       240
     gtaggtgata aattggtatt tactaaccaa tctacaacca tttccttttc ctgtcaagaa       300
     attcaagcaa ctgatgaaca tcttgagtcc atgggctatc tcatccagga tttctttcga       360
     aacggttgtc gggcaaaccg ggacctcttt gccatgagac ttgcgaccct ggtgagggtg       420
     atacgagaga ccatcaacga aggggttctg gagtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page