(data stored in ACNUC7421 zone)

EMBL: CP002116.PE43

CP002116.PE43        Location/Qualifiers
FT   CDS_pept        44427..45500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0043"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843; KEGG: bcl:ABC3473 hypothetical protein; SMART:
FT                   regulatory protein LacI; SPTR: Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79203"
FT                   /db_xref="GOA:E1R6S1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S1"
FT                   /protein_id="ADK79203.1"
FT                   /translation="MKKIVTQKDIAQALHIGQMTVYRALHNKGNISPELRERILAYADE
FT                   VGYQANRAAQTLVQKKVTRIVLFSTDTPRFFWDSVESGIGLAKEQVKHFNYSVEYYRIA
FT                   NKNSVEYLSALTAVIAEGVDAVGLVNNEEYDMTAIFRVLDDAQVPYILFNIDAKESHRL
FT                   CYIGPDYIGGGRLAAEFLGKCVAGTSKILVITDDHTKQNISAEVNHLRIDGFMSVMKER
FT                   YPSIINTIQGVDLEQGATDVGLELKTIINESEVCFDAIYLVPPINQLLMEVLAESKRPL
FT                   PKVLLHDTFPGYKEFFARDMITAIIFQNPIQQGFYAVKVLEEMVETGFIPRDDIHLVQE
FT                   VMLAENSDLDKNHLSFD"
     atgaaaaaaa tagtgacgca aaaggacatt gcgcaggccc tgcacattgg ccagatgaca        60
     gtatacaggg cccttcataa taaagggaac atttctcctg agttacgaga gcgaatactc       120
     gcctacgctg acgaggtcgg ttaccaagcc aatcgggcgg cccaaacctt ggtccagaaa       180
     aaggtaactc gtattgtact gttctctact gacacgcccc ggtttttttg ggactctgtc       240
     gagtctggaa taggacttgc gaaagaacag gttaaacact tcaattattc cgtggagtac       300
     tatcggattg caaacaaaaa tagtgttgag tacctttctg ccttgacggc cgttattgcc       360
     gaaggggttg atgccgtcgg tcttgtcaac aatgaagaat atgatatgac tgcaattttc       420
     cgtgtattgg atgatgcaca ggttccttat attttgttca atattgatgc taaggagtcg       480
     catcgccttt gttatatcgg ccctgattat ataggaggag gccgacttgc ggctgaattc       540
     ttggggaaat gtgtggcagg aacgtcgaaa atccttgtaa taaccgatga tcatacaaag       600
     cagaatattt ctgcagaagt taatcatctg cgtattgacg gctttatgtc cgtgatgaaa       660
     gagaggtatc catccatcat caataccata cagggcgttg accttgaaca aggtgcgaca       720
     gatgttggac tcgaactcaa gactatcata aacgagtccg aggtatgctt tgatgcgata       780
     tatttggtcc cgccaattaa tcagcttctt atggaagtcc ttgccgaatc aaaaaggccg       840
     ctaccgaaag tccttttaca cgataccttc cccggctaca aagagttttt tgcaagagat       900
     atgataacgg caattatttt tcaaaaccct attcagcagg gcttttacgc cgtcaaggtt       960
     ctcgaggaga tggtggaaac cggcttcata cctcgggacg atatccattt ggtgcaggaa      1020
     gtcatgttgg ctgaaaatag cgatcttgat aagaatcacc tgtcatttga ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page