(data stored in ACNUC7421 zone)

EMBL: CP002116.PE437

CP002116.PE437       Location/Qualifiers
FT   CDS_pept        461434..462717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0450"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG4277 DNA-binding protein with the
FT                   Helix-hairpin-helix motif; InterPro IPR007197:IPR000532;
FT                   KEGG: hmo:HM1_1854 radical sam domain protein, putative;
FT                   PFAM: Radical SAM domain protein; SPTR: Radical sam domain
FT                   protein, putative; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79597"
FT                   /db_xref="GOA:E1RB67"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB67"
FT                   /protein_id="ADK79597.1"
FT                   /translation="MNTEAKIKILADAAKYDVSCASSGSTRLGPKGGMGSTLSAGICHS
FT                   WSSDGRCISLLKVLFSNACRYDCSYCVNRASAGGRRVSFTVDELTNIAMAFYRRNYIEG
FT                   LFLSSGIFAEPDVVMEQLLRVAITLRSEHRFGGYIHMKAIPGASQELVAAAGRWVDRMS
FT                   VNIELPSERSLNRLAPQKKRRDILGPMGWMRTEIDHYREGMEEFRHSSFLKTKPASFVP
FT                   AGQSTQLIVGASPEADGTILSLADGLYKSYGMKRVYYSAFVPTVSRAEGPGLDLGTPNR
FT                   LKAREHRLYQADWLMRFYGFAFDELVGDRSASLDPELDPKSHWAIVHRDHFPVDLERAD
FT                   YEVLLRVPGIGVRSAHRLVVARREGPLNFELVARLGVVLSRAKYFVTCGGRSLVSADYS
FT                   EKVLRMRLGEGPDAFGQLSLFDAISGEL"
     atgaataccg aagcgaagat caagatactt gccgatgcgg ccaagtatga tgtttcttgt        60
     gcctccagcg gaagtacacg tttaggtccc aagggtggta tggggtcaac cctatctgcg       120
     ggaatctgtc attcctggag ttcggacggc agatgtataa gtttgctgaa ggtcctcttt       180
     tcaaatgcct gccgttacga ctgttcctac tgcgtgaata gggcttccgc cggtggtaga       240
     cgggtttcct ttaccgtaga tgagcttacg aacattgcaa tggcctttta tcgaagaaat       300
     tatattgaag ggcttttcct ttcttccggg atttttgccg aacccgatgt ggtgatggag       360
     cagcttttac gggttgccat aacattgcgg agcgaacacc gtttcggcgg atatatccat       420
     atgaaggcca tccccggtgc ttcccaagag cttgttgccg ccgccggtcg ttgggtcgac       480
     cgtatgagcg tcaatatcga acttccaagc gaacggtctc tcaatcgtct ggcaccccag       540
     aaaaaacgtc gggatatcct tggccccatg gggtggatgc gtaccgaaat cgaccactac       600
     cgtgaaggta tggaagagtt tcgccattcc tcgtttttga aaacaaaacc tgcctccttc       660
     gttcccgccg gacagagtac acagctcatt gtgggggcta gccccgaggc cgacggcacc       720
     attctttccc tcgccgacgg cctctataaa agctacggta tgaaacgggt ctactattcg       780
     gcctttgttc caacagtttc ccgggccgag gggccaggcc ttgatctggg gaccccgaat       840
     cgtctcaagg ctcgggaaca tcgcctctat caggctgatt ggctcatgcg cttttacggt       900
     tttgccttcg atgagcttgt gggggaccgt tctgcatctc ttgatcccga acttgatccg       960
     aaaagtcatt gggcgattgt acaccgcgac cattttccgg tggatctcga gcgtgccgat      1020
     tacgaagtgc ttctacgggt tcccggaatc ggagtgcggt ctgcacatcg tcttgtggtt      1080
     gcaaggcgcg agggccccct gaattttgag ctggtggcgc gtttgggtgt ggtcctttcc      1140
     cgtgccaagt actttgtcac ctgcggtggt cggtcccttg tttccgcaga ctattccgaa      1200
     aaggtactta ggatgagatt gggggaaggc cccgatgctt tcggtcagct ttctcttttt      1260
     gatgctatca gcggagagtt gtga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page