(data stored in ACNUC7421 zone)

EMBL: CP002116.PE44

CP002116.PE44        Location/Qualifiers
FT   CDS_pept        45662..46897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0044"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   extracellular solute-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: Extracellular
FT                   solute-binding protein family 1; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79204"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S2"
FT                   /protein_id="ADK79204.1"
FT                   /translation="MKKIGVMIVLLIFLSTFTYASGDQEAGKTELFFFCGHGDLEEGTK
FT                   EIIAAYEETHPNIKITTIFNSKDYATQFQSMMATDTLPDIVMVDQERLKEFVAADMLLD
FT                   LSDRPVASRLFDVAKEPNMIDGRLYSVPFHLQGYGMLYNPKLLAQAHINKVPSTLSELK
FT                   AAVDKLNAAGITPFTSMFNETWAADQYLLFGISPILNQDPSLVAGLYNGTVKFSDAKFS
FT                   EVFNYIDILKDNVPENPFSYSFGEGASYFGQGKAALAIHGDWILRTALAVDPNLDVHLA
FT                   ALPYSNVKENNKIVVGVANGLGIIKNSKHLQEAIDFFDYYSTLESAQILSKYNFSYVPQ
FT                   KGFDTKGLHAVYTDISEALDQGNVIPWEWLKVAPGGVKLEAGQSMQAYLSNQISQDQVM
FT                   ENVQAAFDDAVK"
     atgaagaaga taggggtaat gatcgtattg cttatttttt tgagtacgtt tacctatgca        60
     tcaggagatc aggaagcggg aaagaccgaa ttgttttttt tctgtggtca tggtgatctc       120
     gaagagggaa cgaaggagat aattgcggcg tacgaagaga cgcatcccaa tataaaaatt       180
     acaacgattt ttaattcaaa agactatgct acgcaatttc aatcgatgat ggcaaccgat       240
     acattgcctg atatcgttat ggttgatcag gaacggctga aagaatttgt tgctgcagat       300
     atgttgttgg atctaagcga caggcccgtt gcatctcgct tgtttgatgt tgcgaaggaa       360
     ccaaacatga tagacggaag gctttattcg gttccgtttc atctccaagg ctatgggatg       420
     ttgtacaatc cgaaattgtt ggcgcaagca catatcaaca aggtcccctc tactttgtcc       480
     gaattgaaag ccgcggtcga caaacttaat gccgcaggga ttactccttt tacgtcgatg       540
     tttaatgaaa cgtgggcggc cgaccagtat cttttgttcg gaatcagccc gatcttaaac       600
     caggacccca gcctggttgc gggcctgtat aatggtacgg tgaaattcag tgatgcaaaa       660
     ttctccgagg tatttaacta tatcgatatc ctcaaggaca atgttccgga aaatcccttc       720
     tcctattcgt ttggggaagg agccagttat tttggacagg ggaaagctgc actggcaatc       780
     cacggagact ggattctgag aacggcactt gccgtcgatc ctaatcttga tgtccatttg       840
     gcagcactac catattcgaa cgtgaaagaa aataacaaga ttgtcgttgg tgtggcaaac       900
     ggacttggga tcatcaaaaa tagcaagcac ctgcaggagg caatagactt tttcgattac       960
     tattcgaccc ttgaatcggc ccagattctt tcgaaatata atttttcgta tgttccgcag      1020
     aagggatttg ataccaaggg actccatgcc gtttatactg atatctccga agcgttggac      1080
     cagggcaatg ttattccctg ggaatggtta aaggtcgctc ccggtggggt gaagctggaa      1140
     gccggacagt cgatgcaggc ttatctcagt aaccaaatat cccaggacca agtcatggaa      1200
     aatgtccaag cggcatttga tgatgcagta aaataa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page