(data stored in ACNUC7421 zone)

EMBL: CP002116.PE444

CP002116.PE444       Location/Qualifiers
FT   CDS_pept        468316..469230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bdu:BDU_173 hypothetical protein; SPTR:
FT                   Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79604"
FT                   /db_xref="GOA:E1RB74"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB74"
FT                   /protein_id="ADK79604.1"
FT                   /translation="MKRLLLVLFLAPMLLPAQEITEQPLIVSRQLFLPAEYYVGDSVEL
FT                   RLTLEGVDPDSLEIPSTLPDVPWIEIRDISIERDSVGSELTIHFTTYMPGTRTLPSIVF
FT                   GEGKVLEGVKIHASSILDDTNAPFSPARGQLLLPGTSVGLILFGLLIFLGPVLTLLLAG
FT                   KGRRFFRGIMERHRGRRPARIFYRRLRELEDNFDKIAGRDFYFTMTGILRSYLTQRTGE
FT                   DFLSATSREFGFLCDRFFDDQALVAALAEMDHISDGVKFGGERVHTDRKRHDLALLKDV
FT                   ASYVERRAEGHRSSNRRKGRGSV"
     gtgaagcgat tattacttgt gctgtttctt gctccgatgt tactcccggc ccaagagatt        60
     acggagcagc ctctgatcgt cagccgacag ctcttcctcc ctgccgaata ctatgtaggc       120
     gacagtgtcg agcttcgtct caccctggaa ggggttgatc ccgattcatt ggaaattcct       180
     tcgacccttc ccgatgtacc gtggatcgag atacgggata tttccattga aagagattcc       240
     gttggctccg aacttaccat tcattttacc acctatatgc ctggtactag aaccctcccc       300
     tccattgtct ttggggaagg gaaggttctt gagggggtaa agattcatgc ttcatcgatt       360
     ctggatgaca caaatgcccc cttttctcct gcgcgtggtc aacttttact accggggacc       420
     tccgtcggct tgattttgtt tgggctgctt atcttcctcg gacctgttct taccttgctt       480
     ttggcaggga aaggcaggag attctttcgt ggtatcatgg aacgacaccg gggccgccga       540
     cctgctcgta tcttttacag acgattgagg gagctggaag ataacttcga taaaatcgcc       600
     ggacgtgatt tctattttac catgaccggg atccttcgtt cctatcttac ccaacgtacc       660
     ggagaggatt tcctttctgc taccagcaga gagttcggct ttttgtgcga tcgctttttt       720
     gatgatcagg ctcttgttgc tgctttggcg gaaatggacc acatatccga cggcgtaaaa       780
     tttggtggag aacgggtaca caccgatcgt aagcgccacg atcttgcact gctgaaagat       840
     gtggcatcct atgtggaacg tcgtgccgag ggccatcggt cttcgaaccg acgtaaggga       900
     cggggaagcg tatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page