(data stored in ACNUC7421 zone)

EMBL: CP002116.PE45

CP002116.PE45        Location/Qualifiers
FT   CDS_pept        46998..47873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0045"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   pjd:Pjdr2_0386 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79205"
FT                   /db_xref="GOA:E1R6S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S3"
FT                   /protein_id="ADK79205.1"
FT                   /translation="MKKHDYSADYFLFILPAFSLFFLFFLIPVFNGVRYSFFEWNGISA
FT                   TKTFVGLENFRNILNDKIFFEAFKNTLKFTVVHVLTVNLLALFLAVLLTKPSVVGRNFF
FT                   RGIFFLPNVLSLIVVGQIWKFFLGQASFELGKKIGVAVFQIGWLSDPQVALYSTIIASV
FT                   WQATGWYMLIYIAGITAIPRELYEAATIDGGRQVFVFRHITLPLLIPSLTICIFLSTIN
FT                   SLRVFDIVYAMTGGGPGHATETALLNIYNTTFNSFKYGYGTAKAIVLLIVIIVVSFTQI
FT                   ILLKRKEVDL"
     atgaaaaagc acgattatag cgcagattat tttttgttta ttcttccggc attttcttta        60
     ttctttcttt ttttcctgat tccggtcttc aatggggtac gttatagttt ttttgaatgg       120
     aatggcatat ccgcgacaaa gacatttgta ggtcttgaga atttcaggaa tattcttaac       180
     gacaaaatct ttttcgaagc tttcaagaat acgttgaaat ttaccgtcgt acatgtactg       240
     accgtaaatc ttcttgcact ttttttggcg gttctcctga caaagccttc tgttgtcggg       300
     cgaaactttt ttcgcgggat attctttttg ccgaatgtcc ttagcctcat tgtggtcggg       360
     cagatttgga aattttttct tggtcaagct tcattcgaat tagggaaaaa aatcggggtt       420
     gcagtgtttc agataggatg gctgagtgat ccacaggtcg ctctctattc gacgatcatt       480
     gcttcggttt ggcaggctac ggggtggtat atgctgatct atattgccgg gataacggca       540
     atacctcggg aactgtacga ggctgcaaca atcgacggag gacgtcaggt ttttgttttt       600
     cgtcatatca cattaccgct gcttatcccg tctctgacta tatgtatttt cctttcgaca       660
     atcaattctt tacgggtatt cgatattgtc tatgcaatga cgggaggtgg gcctggtcat       720
     gcaacagaga cggccttgct aaatatttat aataccacat tcaattcttt caaatacgga       780
     tatgggacgg caaaagccat tgttttactg attgttatta ttgttgtttc atttacacaa       840
     attatattgc tgaaacgcaa agaagttgat ttgtag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page