(data stored in ACNUC7421 zone)

EMBL: CP002116.PE451

CP002116.PE451       Location/Qualifiers
FT   CDS_pept        474624..474980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0464"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="COGs: COG1734 DnaK suppressor protein; InterPro
FT                   IPR020460:IPR000962; KEGG: tpp:TPASS_0096 possible DnaK
FT                   suppressor; PFAM: zinc finger DksA/TraR C4-type; SPTR: DnaK
FT                   suppressor, putative; PFAM: Prokaryotic dksA/traR C4-type
FT                   zinc finger; TIGRFAM: RNA polymerase-binding protein DksA"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79611"
FT                   /db_xref="GOA:E1RB81"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB81"
FT                   /protein_id="ADK79611.1"
FT                   /translation="MDKVFEEKMKDSLLAMKEELVRSLISESEDFEALVRDMDPKDLVD
FT                   VAADDIDRKTLEALNAQEVKRIRLIDSALSRLKNGRYGLCMRCGKKIPTERLEAIPYAL
FT                   MCIECKSSDERRSR"
     atggataaag tttttgaaga gaaaatgaaa gactcgctgt tggcaatgaa agaggagctc        60
     gttcgatctc ttatctccga gagcgaagat tttgaggcac ttgttcgcga tatggatcca       120
     aaggatcttg tcgatgttgc cgccgacgat atcgatcgga agacccttga agcccttaat       180
     gctcaggagg taaaaaggat caggctgatc gactcggccc tctcgagact gaagaacggg       240
     cgttacgggc tctgtatgcg ttgcggaaag aaaattccca ctgaacggct tgaggctatt       300
     ccgtatgcac tcatgtgcat cgagtgtaaa tcgagcgacg agcgaagatc gcgctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page