(data stored in ACNUC7421 zone)

EMBL: CP002116.PE453

CP002116.PE453       Location/Qualifiers
FT   CDS_pept        complement(475458..476126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0466"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: dap:Dacet_1446 beta-lactamase domain
FT                   protein; SPTR: Beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79613"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB83"
FT                   /protein_id="ADK79613.1"
FT                   /translation="MVERIIVGRLNTNCYIYSRWKKECVIIDPGGDYEKIISHMVGKNL
FT                   TPRGIILTHGHLDHVSALGKIIDYYVEQEIHLDIAAHEDDAIFFGSGAREIHEEAFQQM
FT                   GIDGKALFQEMYKPIPDIDLFLEEGKSVFDCDLRVIHTPGHTKGSVCLYSEESDMLFSG
FT                   DTLFFEGVGRTDLFGGDSQALFRSINEKLMPLPDRTRVFPGHGPLTTIERERGYNPYVQ
FT                   "
     atggtagaaa gaattattgt aggaagattg aataccaatt gttacatata ctcccgctgg        60
     aagaaagagt gcgttattat cgatcccggc ggagattacg aaaaaataat atctcatatg       120
     gtcggaaaaa accttacacc cagaggaatc attcttaccc acggccatct ggatcatgtc       180
     tcggcactcg gcaaaattat agattattac gtcgagcaag agatacacct tgatattgcg       240
     gcccatgaag acgatgccat ttttttcgga agcggggcca gagaaattca tgaagaggca       300
     ttccagcaaa tgggaatcga cggaaaggct ctttttcagg aaatgtacaa acccattccc       360
     gatatagatt tatttcttga ggaagggaaa tcggttttcg actgcgatct cagagtcata       420
     catacccccg gtcatacaaa gggcagtgtt tgcctctaca gtgaagagag tgatatgctt       480
     ttctcagggg acacactctt tttcgaagga gtgggaagga cggacctgtt tggaggcgac       540
     agtcaggctc tttttcgaag catcaacgag aagttgatgc cgttacccga cagaacccgg       600
     gtatttcctg gtcacggacc tctcacgacc atcgagaggg agaggggcta taatccctat       660
     gttcagtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page