(data stored in ACNUC7421 zone)

EMBL: CP002116.PE46

CP002116.PE46        Location/Qualifiers
FT   CDS_pept        47882..48712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0046"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: bmq:BMQ_2796
FT                   putative ABC transporter, permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79206"
FT                   /db_xref="GOA:E1R6S4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S4"
FT                   /protein_id="ADK79206.1"
FT                   /translation="MSVEKLLKTILIYIILIIGVSIFIAPFYFVIINSLKTNSEYLVSK
FT                   LVLPSSFYVDNYVATIEMMKYGKTLLNSIVITAFSVFGILVIASMAAYKIARTKGILNT
FT                   ILFFLFLSVFVVPFQSVMIPIVVMARRLSLMNKLYGMVLVYLGLVSPTAIFLYRGFIQT
FT                   IPLSLEECAQIDGASVYQIFFRIVLPLLKPITSTIIILLGLQIWNDFLLPLLMLQTPKN
FT                   YTLPLATMRFFQTYNTAWGNILAATVLSSIPMIILFFSAQKQIVQGVTSGAIKG"
     atgtcagtag aaaaattgct caaaaccatt cttatttata tcattctcat cataggtgtc        60
     agcatcttta ttgctccttt ctactttgta attataaatt ccttaaagac aaattcggaa       120
     tatctagtat caaagctggt tctcccttcc tcattctatg tggacaatta tgttgcaacc       180
     attgagatga tgaaatatgg aaaaactttg ctaaattcga ttgttattac agctttttca       240
     gtctttggaa ttcttgtgat agcttcgatg gctgcatata agattgcaag gacgaaaggt       300
     atactaaata ccattctgtt ttttctcttt ttaagcgtat ttgttgtgcc gtttcagtcc       360
     gttatgattc ccatagtggt gatggccaga cgattgtctt tgatgaacaa actatatggt       420
     atggttctgg tctatctggg tttggtttct ccgaccgcaa tttttctgta cagaggattc       480
     attcagacca ttcccctctc tttggaagaa tgtgcacaga tcgacggcgc ttcggtatat       540
     cagattttct ttcgaattgt tttaccgttg ttgaagccta tcaccagcac cattatcatt       600
     ctcctcggtc ttcagatctg gaatgatttt cttctacccc ttcttatgct gcaaacgcct       660
     aagaactata cgctgccttt ggctacaatg cgctttttcc aaacatataa tactgcttgg       720
     ggaaatattc tggcagcgac ggttttgtct tcaataccta tgataatcct ttttttctca       780
     gcccaaaaac aaattgtaca aggtgtaacc tctggtgcaa taaaaggata g                831
//

If you have problems or comments...

PBIL Back to PBIL home page