(data stored in ACNUC7421 zone)

EMBL: CP002116.PE460

CP002116.PE460       Location/Qualifiers
FT   CDS_pept        482221..483474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0473"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="COGs: COG1457 Purine-cytosine permease and related
FT                   protein; InterPro IPR001248; KEGG: tsi:TSIB_0467 probable
FT                   hydroxymethylpyrimidine transporter CytX; PFAM: permease
FT                   for cytosine/purines uracil thiamine allantoin; SPTR:
FT                   Probable hydroxymethylpyrimidine transporter CytX; PFAM:
FT                   Permease for cytosine/purines, uracil, thiamine, allantoin;
FT                   TIGRFAM: NCS1 nucleoside transporter family; probable
FT                   hydroxymethylpyrimidine transporter CytX"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79620"
FT                   /db_xref="GOA:E1RB90"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB90"
FT                   /protein_id="ADK79620.1"
FT                   /translation="MIDKGARTLSGFGTALLWAGVAVSVSEIWAGSLLQDAGLFAGLLI
FT                   IVIGHLFGGLVLSASGTMGTRYGIMSMQSTRMVLGNRGSIIPSLLNVFQLVGWATIMLA
FT                   LSGSIGASVGHRLGAPFNSKAFWILLIGAGTLAWSFLVGSSKLQWVHTVVIIGLVLISA
FT                   LMTWIALNPHYYTMKPAAADSFSFTRGMRLMDLVIVMPISWVPLISDYSRLAKSERGGF
FT                   WGSFLGYGIVSCWMYGIGLVISLATGTEDPAANILRLMGTLGLTIPAVVLVFASTMTSD
FT                   FPDIYSSACSLFNINSKIKPAWTMWGTGILTIILALFFDLSRFETFLNVVGAFFIPLFA
FT                   ILLTDYFLIRKQDLTGLDFAVGSGMNFSGGFRIKGLLVWGIGTLVYFLARAVDCPLGAS
FT                   ITAFLVSSVIYLLLEKRT"
     atgatcgata agggagctcg tacactcagc ggcttcggta ccgcccttct gtgggcggga        60
     gttgctgtat ctgtgtcgga gatctgggcc ggaagtctgc tgcaggatgc cgggcttttt       120
     gccggattgc ttatcattgt catcggtcat cttttcggcg gacttgtttt gagcgcttcc       180
     ggtaccatgg gaacgcgata tggcattatg tccatgcaga gtaccaggat ggtccttgga       240
     aatcgcggtt caattattcc aagcctgctg aatgtgtttc agctggtagg atgggcgacg       300
     atcatgcttg ccctcagtgg ttccatcggc gccagcgtcg gccatcgcct cggtgctccc       360
     tttaatagta aggctttttg gattcttctt atcggtgcag gtacccttgc atggtctttt       420
     ctcgtcggta gttcgaagct tcagtgggtc cacaccgtgg taatcatcgg ccttgttctt       480
     atatctgctt tgatgacgtg gattgccctt aatccgcact attacaccat gaaacctgcg       540
     gccgccgact ctttttcctt tacccgcggt atgcgcttaa tggatcttgt tattgttatg       600
     cccataagtt gggtacctct tatctccgac tactctcgtt tggccaaaag cgagcggggt       660
     ggattttggg gatctttttt gggatacggc attgtttcct gttggatgta tgggataggc       720
     cttgttatca gtttggcaac ggggaccgag gatcctgcag ccaatattct gcgtttgatg       780
     gggaccctcg gtttgacgat ccctgccgtc gtgctggtct ttgcatcgac tatgacaagc       840
     gattttcccg atatctactc ttcggcctgt agcctcttta atatcaattc gaaaatcaaa       900
     ccggcttgga ccatgtgggg aaccggaatc cttacgatta ttctcgccct cttttttgat       960
     ctttccagat ttgagacctt tctaaatgtg gtcggcgcct tttttattcc gctttttgct      1020
     attttactta ccgattactt ccttatccgg aaacaggatc ttaccggact tgattttgcc      1080
     gtcggatcgg ggatgaattt ttccggtgga ttcaggataa aagggcttct tgtctgggga      1140
     atcggaaccc tcgtctattt tcttgcccga gcggttgact gccccctggg tgccagtatt      1200
     accgcctttc ttgtttcttc tgttatctat ctgctgcttg aaaagagaac ttag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page