(data stored in ACNUC7421 zone)

EMBL: CP002116.PE47

CP002116.PE47        Location/Qualifiers
FT   CDS_pept        48721..50745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0047"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="COGs: COG1501 Alpha-glucosidase family 31 of
FT                   glycosyl hydrolase; InterPro IPR000322; KEGG: sma:SAV_2570
FT                   glycosyl hydrolase; PFAM: glycoside hydrolase family 31;
FT                   SPTR: Putative uncharacterized protein; PFAM: Glycosyl
FT                   hydrolases family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79207"
FT                   /db_xref="GOA:E1R6S5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S5"
FT                   /protein_id="ADK79207.1"
FT                   /translation="MNKINTTPFSADKEGIVWKGGRETVMVQAVLPGVIRVQAWQAPSC
FT                   TEDYYTIEASHASINDNDLSIRIEKEKARLSSGDLQVAISSGGRLSFSNVQTGRLLFQE
FT                   ADWLPGNPTLFPKSRTYKRKNGAWSIRQLFLSHDEERFYGLGQHRNGLFNYKGAVIPLC
FT                   QQNGETSIPFLLSSKMYGFVWNNPSLGEVELVKNRTSWVAEEARKIDYYVITGGDYKTI
FT                   YSRYADVTGHSPQLPFWATGFWQSKLRYASQEEVLNVVDEYQKRGIPLSAIVIDYLHWT
FT                   RMGDFEWDERLWPSPETMVETLRQKDVTVVASIWPAINPKSKHAEELSNKGYLVDSVKG
FT                   MNLFFPFFDTNDIPPVFLQYYDATNPDARTYFWKKVKAMYYDKGIKNYWLDGCEPEIYP
FT                   FDMDNLLFSLGDGKAVANLYPLCHQRGIAEALYAEGERDFVLLCRSGWLGTQRFGSALW
FT                   SGDILSNWQTFADQIHVGLHVGMSGIPWWTSDIGGFMEGNIHDEGFQELLIRWFEYGIF
FT                   CPLCRLHGNRDPRPENPTESGADNEVWSFGDKAYGILQKMLRIRETLRPYIYREMERTS
FT                   QDGLPMMRPLFFDYPEDSACWDIGDEYLFGSQILVAPVHEKGAVGRSVYLPQNRQWMDA
FT                   WTGTLYEGGVHLQVSAPLDMIPVFLSPDCDEIVVKAFRE"
     atgaataaaa taaacacgac tcctttttct gcggataagg aaggtatagt ctggaaaggc        60
     ggccgtgaga ccgtaatggt gcaggccgta ttaccgggag tgattagggt acaagcttgg       120
     caggccccat cctgtacgga agattattat accattgagg cttctcatgc ttcaataaac       180
     gataacgact tatcaatacg gattgagaaa gaaaaggcac ggctgtcttc gggggatctt       240
     caggttgcaa tttcatcggg aggacggctt agcttttcga atgtacagac aggccggttg       300
     ctttttcagg aagccgactg gctgcctggt aacccaactc ttttcccaaa aagtcgaacg       360
     tacaaaagaa aaaatggggc ctggagtata cgacaattgt tcctttcaca tgacgaagaa       420
     agattttacg gccttggtca gcaccggaac ggattgttca attataaagg tgctgttatt       480
     cccttatgtc agcagaatgg cgagacctcg attcccttcc tgctgtcttc gaaaatgtat       540
     ggctttgtat ggaataatcc gtcgttggga gaggtcgaat tggtgaagaa ccgcacctct       600
     tgggtagcgg aggaggcgcg gaaaattgat tactacgtca tcaccggagg tgattataaa       660
     acaatttatt cacggtatgc agatgtaacc ggccattccc cgcaacttcc tttttgggct       720
     accgggtttt ggcaaagtaa gttacggtat gcttcccaag aagaagttct gaacgttgtg       780
     gatgaatacc aaaaacgggg aataccctta tcggcaatcg tcattgatta tttacattgg       840
     acacgcatgg gggatttcga gtgggatgag cgtttgtggc cttcaccgga aacaatggtc       900
     gaaacattgc ggcagaagga cgtaaccgtc gtcgcttcga tatggccggc aataaatcct       960
     aagtcgaaac atgcggaaga attatccaat aaagggtacc tggtcgattc tgtaaaagga      1020
     atgaatcttt tttttccatt ctttgatacg aacgatattc caccggtctt tctccaatat      1080
     tatgatgcca ccaatcctga tgcacgcacc tatttttgga agaaagtgaa ggcgatgtat      1140
     tacgacaagg ggattaaaaa ttactggttg gatggctgtg agccggagat atatcccttt      1200
     gatatggaca accttttgtt ttctctggga gatgggaaag ccgttgccaa tctttacccc      1260
     ttgtgccatc aaagagggat agccgaggca ttatatgcag agggtgagag ggattttgtg      1320
     ctcttgtgcc gttctggctg gcttggaaca caacgctttg gttctgccct ttggtctggg      1380
     gacattttgt cgaattggca gacctttgcc gaccagattc atgtaggcct gcatgtcggt      1440
     atgagcggta tcccgtggtg gacttccgat atcggaggat tcatggaggg taatatccat      1500
     gatgaaggat ttcaggaact gcttatacgg tggttcgaat atggaatttt ctgtccttta      1560
     tgccggctcc atggtaatag ggatccccgg ccggaaaatc ccacggaatc tggtgcggac      1620
     aatgaggttt ggtccttcgg tgacaaagcc tatggaattt tgcaaaagat gcttagaatc      1680
     agagagacgt tacggccgta tatctaccgg gaaatggaac gaacttctca ggatggactt      1740
     cctatgatgc ggccgttatt tttcgattat ccggaggatt cggcgtgctg ggatatcggg      1800
     gacgaatacc tattcggctc ccagatcctt gttgcgcccg tacatgaaaa gggtgctgtc      1860
     ggcagaagtg tctatctacc ccaaaatcgg caatggatgg atgcgtggac aggaaccttg      1920
     tatgaaggtg gggttcatct tcaggtttct gcgccattag atatgattcc cgtttttcta      1980
     tcaccggatt gtgatgagat tgtggtaaag gcttttcggg aatag                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page