(data stored in ACNUC7421 zone)

EMBL: CP002116.PE473

CP002116.PE473       Location/Qualifiers
FT   CDS_pept        complement(498638..499564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0486"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="COGs: COG1893 Ketopantoate reductase; InterPro
FT                   IPR013332:IPR013752:IPR003710; KEGG: gbm:Gbem_0788
FT                   2-dehydropantoate 2-reductase; PFAM: Ketopantoate reductase
FT                   ApbA/PanE domain protein; PRIAM: 2-dehydropantoate
FT                   2-reductase; SPTR: 2-dehydropantoate 2-reductase; TIGRFAM:
FT                   2-dehydropantoate 2-reductase; PFAM: Ketopantoate reductase
FT                   PanE/ApbA; Ketopantoate reductase PanE/ApbA C terminal;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79633"
FT                   /db_xref="GOA:E1RBA3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA3"
FT                   /protein_id="ADK79633.1"
FT                   /translation="MTRIAILGAGALGSLYAYELSKVPSNSCFFIADGDRAKRLKKALP
FT                   TVNGARLRAEVREPNEGSPADLLIVSLKYHHLQEALASALPFVGEQTTIISVMNGVDSE
FT                   EIIAARFGQDHVVHCVALGMDALRENGKVHYTTCGRLVIGRPEKGRTDVQEDRDIGKIE
FT                   TVCRGSGIGLEVSDDILKSLWWKFMINIGVNQISAITGASYRFFQDRKSPAHALMNDTM
FT                   KEVVLVAQKKGIGLDETDIAAWYTVLDSLGPDNKTSMLQDVEAGRKTEVEMFAGILLKL
FT                   GKEVGLDLPINSFILKTILSIEGVAGK"
     gtgacacgga tagccatttt gggagcaggt gcgctcggat cgctttatgc ttacgagctg        60
     tcgaaggtgc cgtcgaacag ttgtttcttt attgccgatg gggatcgagc gaaacgactc       120
     aaaaaggcct tacctacagt aaatggggca aggctccgag ccgaagtcag ggaaccgaat       180
     gaggggtctc ctgccgacct cctcattgtg tctcttaaat atcatcatct gcaagaggct       240
     cttgcttcgg cccttccctt tgtgggggaa caaaccacca ttatatcggt tatgaacgga       300
     gtcgatagtg aagaaattat tgccgcccgt tttggccagg accatgttgt tcactgtgtc       360
     gcgctcggta tggatgccct gcgagaaaat gggaaggtgc attatacaac atgtggaagg       420
     cttgtcattg gaaggccaga aaaagggcga acggatgttc aagaagatcg ggatatcgga       480
     aagatcgaaa ccgtttgtcg tggatcgggc atcggtcttg aggtctcgga tgatatccta       540
     aaatcgcttt ggtggaagtt catgatcaat atcggagtga accagatatc ggcgatcacc       600
     ggagcatcgt accgtttttt ccaggaccgc aaaagtccgg cacacgcctt aatgaatgat       660
     accatgaaag aggtcgttct tgttgcgcaa aagaagggaa taggactcga tgagacggat       720
     atcgctgctt ggtatacggt tctggatagc ctggggcccg ataataagac atcgatgctc       780
     caggatgttg aagcggggcg aaaaacggaa gttgagatgt ttgccggaat tctcctgaaa       840
     ctcggcaaag aagttggact tgatcttccg atcaatagct ttatcctcaa aaccattcta       900
     tctatcgaag gggtggcagg caaatag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page