(data stored in ACNUC7421 zone)

EMBL: CP002116.PE474

CP002116.PE474       Location/Qualifiers
FT   CDS_pept        499738..501561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0487"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089; KEGG: tde:TDE0181
FT                   methyl-accepting chemotaxis protein; PFAM: histidine kinase
FT                   HAMP region domain protein; chemotaxis sensory transducer;
FT                   SMART: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; SPTR: Putative
FT                   methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Methyl-accepting chemotaxis protein (MCP) signaling
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79634"
FT                   /db_xref="GOA:E1RBA4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA4"
FT                   /protein_id="ADK79634.1"
FT                   /translation="MSIAKKIVLGSLLIVMIMGTALIATTIRLQKAAISIREVAELGDW
FT                   RLLGEQYRAQVYRLLSSAQSLLLREDERIPADDVMALRLSVSEIRKLHTTLAEVSSEIP
FT                   QLRPEVSALSDEAISYIDRIDKEVILRLFARERVDPKIVESIAHDNIDTLEVKLRDLEG
FT                   AIRTIIVDRTTDEERQAAAGIHWTVGGLLLTLLCVMLITFVLTKSIAGPVKKMGMLLSS
FT                   LADGGADLALRLPDRGNDEIARMGGSFNQFMESLTEMVSQLSGTVSEGVFIGETLQKIT
FT                   QQEQEAAFVLRNGLNRVERNHETLGESIQNTLGGARSIRDLSGDIAGQLGLQHEHINTT
FT                   TEQTAILVSDITMLSEKSLAGIELLSLFSQNLEQGMNSLSLFEEVAGKTMDALDRMGSS
FT                   LSAIEDIAGQTDVLAINAAIEAANAGEAGKGFGVVSTHIRSLSEEVGKGVGRILERLSE
FT                   AKESLTTMRALIVTNSGIFSQLEASAGKVVATFQEMHQRLGVVAESGESVGVQTHQLTE
FT                   RARSIEKMAMSADANAAKIVQEFELMKERDSGIENDLAEMVAQAAGLEHHTAMLLESSS
FT                   RNASVADTLSGLIDKFIFPELDGQGAKDQAG"
     atgagtattg ccaagaagat tgtcctcggt tctttgctca tcgttatgat tatggggacg        60
     gcgttgatcg ctaccaccat caggttgcaa aaggctgcaa tttcaattcg cgaggttgca       120
     gagcttggtg actggcgatt actcggagaa cagtaccggg ctcaggtcta tcgccttcta       180
     agttccgccc agtcactgct tcttcgcgag gacgaaagga ttcctgcgga tgatgtgatg       240
     gcgttacgtc tttccgtaag cgaaatacga aaactccata ccacccttgc agaggtttct       300
     tctgaaatac cgcagctgcg gcctgaagta tcggcccttt cagatgaagc aatctcctat       360
     atcgatcgca tcgataaaga ggtcattctc aggcttttcg cccgggaacg tgtcgacccc       420
     aagatcgtag agtcgattgc tcatgataat attgataccc ttgaagtcaa attgagggat       480
     cttgaaggtg caattaggac gatcattgtt gaccgaacca cggacgagga gcgtcaggct       540
     gcagccggta tacattggac agtggggggg cttctgctca cgcttttatg tgtgatgctt       600
     attacgtttg tcttgacgaa atcgatagca ggtccggtta agaagatggg aatgctactc       660
     tcatcgcttg ccgatggtgg tgccgatctt gctttacgtc ttcccgatcg tggaaacgat       720
     gagatagccc gtatgggagg aagctttaat caatttatgg aatccctgac ggagatggtg       780
     tctcagcttt ccggtaccgt ttccgagggt gtttttattg gtgaaaccct tcaaaagatt       840
     acccaacagg aacaagaagc ggcttttgtg ctacgcaacg gactcaatcg ggtagaacgc       900
     aatcacgaaa cacttggtga gagtatacaa aacacacttg gcggcgcacg atctattcgt       960
     gatctttccg gcgatatagc cggtcagctc ggcttgcaac atgagcatat caacacaaca      1020
     acggaacaaa cagccatcct tgtttccgat attaccatgc tgtcggaaaa gagtcttgcc      1080
     ggtatcgaac tgcttagtct tttttcccaa aacctcgaac aaggtatgaa ttctctttct      1140
     ctatttgaag aggtggcggg aaagacaatg gatgctctgg acaggatggg atcgtctctt      1200
     tccgccatcg aagatatagc gggccaaaca gatgttcttg ctattaatgc cgccattgag      1260
     gccgctaatg caggagaggc cggtaaggga ttcggtgttg tttcgaccca tatccgttct      1320
     ctctccgaag aggttggaaa gggggtcggc aggatattgg agaggctttc ggaggcgaaa      1380
     gagagcctta cgacgatgag ggcattaatt gtcaccaaca gcggtatctt ttcccaactc      1440
     gaggcatcgg cgggtaaggt ggttgccaca ttccaagaga tgcatcagag acttggcgtt      1500
     gtggcggaat ccggggaaag tgtcggtgtc caaacccatc aactgacgga acgagcgcga      1560
     tcaattgaaa agatggccat gtctgccgat gcaaatgcag caaaaattgt tcaagaattt      1620
     gaattgatga aagagaggga ttcggggatt gaaaatgatc ttgccgaaat ggtcgctcaa      1680
     gctgccggcc ttgagcatca cacagcaatg ttgttggaaa gttccagtcg aaacgcttcc      1740
     gttgccgaca ccctttcggg gctcatcgac aaattcatct ttcctgaact cgatggccag      1800
     ggagcgaaag atcaggcggg atag                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page