(data stored in ACNUC7421 zone)

EMBL: CP002116.PE476

CP002116.PE476       Location/Qualifiers
FT   CDS_pept        502897..504315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0489"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2211 Na+/melibiose symporter and related
FT                   transporter; InterPro IPR011701; KEGG: tna:CTN_1540
FT                   sugar:cation symporter family protein; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: Sugar:cation symporter
FT                   family protein; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79636"
FT                   /db_xref="GOA:E1RBA6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA6"
FT                   /protein_id="ADK79636.1"
FT                   /translation="MKKRNYIAYGLGDLYGGGSFFIISTFSMYFLINVAGLNPLLAGLV
FT                   PGFGKIWDSVSDPLMGYISDHTKSRLGRRRVFFLIAILPIAVTFTLLWLPVSCPGQLST
FT                   FLYYVVAYLFFYSCSTMVLVPYSALSAEMTLDFTERNRLTGTRMIFSMIATLIGGLVVQ
FT                   PLINAFPSQEQGHLVMGLVFGTLFAVPYLFVFLGTWELPVVQKPLGKEKSVFRNFGSIY
FT                   QNRSFRIHIIMYICSYAAMDILMAWLKFYLIDYLRRPGFITVGLGTILVSQMAALPLYV
FT                   ALADKRGHAVSYRMGLMLWGLAIAMMAFQTPDSSVVALFINCLLIGGGMSAGVVIPFQL
FT                   LPFVTDVDTLMTGEHRAGTYAGAMTLIRKLIQGAFVLPMLGLLLNMIGYTPHPADVDLV
FT                   QSASTIFWLRGLFIVLPLLLILVGIKASTRFPITPESHAILRSELERVEAGGRREDAPE
FT                   RTKTVCQRLTGKPY"
     atgaaaaagc gcaattacat cgcttacggt ttaggcgatc tatacggcgg tggttccttt        60
     tttatcatca gtaccttttc catgtacttt ttgatcaatg tggcgggact taatccattg       120
     cttgccggcc tggtccctgg ttttggaaag atttgggact ctgtttcaga ccctcttatg       180
     gggtatataa gtgatcacac aaagagtcgt ttggggcgta ggcgagtttt cttcctcatt       240
     gccatacttc ccattgccgt tacatttacc cttctgtggc tgccggtctc atgtcccggt       300
     cagctgagca cgttcctcta ttatgtcgtt gcgtatctct ttttctacag ctgttcgacc       360
     atggttttgg tcccctattc ggccttgagt gcggaaatga ccttggattt taccgaacgt       420
     aatcgtctga ccggcaccag aatgattttc tccatgattg caacgctgat cggcgggctt       480
     gtggttcaac ctctgattaa tgcctttcct agtcaggaac agggacatct tgtgatgggg       540
     cttgttttcg gtaccctttt tgcggttccc tatctttttg tatttcttgg aacctgggag       600
     cttcccgttg tccaaaagcc tcttggcaaa gaaaaatctg tctttcgaaa ttttggatcg       660
     atctatcaaa atcgctcctt tcgcattcat atcatcatgt atatttgttc gtatgccgcc       720
     atggatattc tcatggcttg gctgaaattc tatctgatag actatctgcg tagacccggc       780
     tttataaccg ttgggcttgg gacgattctt gtgagtcaga tggcagcgct ccctctatac       840
     gttgcattgg ccgataaacg gggtcacgca gtttcttatc ggatgggatt aatgctttgg       900
     ggcctcgcta ttgctatgat ggcgtttcaa acgcctgata gctccgttgt cgccttgttt       960
     ataaattgtc tgctgatcgg tggcgggatg tccgccgggg ttgtcattcc cttccaactg      1020
     cttccctttg ttaccgatgt ggacaccctg atgaccggtg aacatcgtgc cggtacctat      1080
     gcaggtgcca tgacccttat tagaaagctc atacagggag cctttgtcct gcctatgctt      1140
     ggtctcctgc tcaatatgat tggttacacc cctcatcccg ccgatgttga tctcgtgcag      1200
     tctgcctcga cgattttctg gctcagaggc ctttttattg tactccctct gttgctcatt      1260
     cttgtgggta tcaaagcgag tacccgtttt ccaattacac ccgagagtca tgcaatcctt      1320
     cgttcggaat tggagagagt agaggcaggc ggcagacggg aggatgcccc agaacggaca      1380
     aagaccgtat gtcagcggct taccggaaaa ccctattag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page