(data stored in ACNUC7421 zone)

EMBL: CP002116.PE477

CP002116.PE477       Location/Qualifiers
FT   CDS_pept        complement(504323..504907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wpi:WPa_0135 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79637"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA7"
FT                   /protein_id="ADK79637.1"
FT                   /translation="MKDKGVLRRLTNELAEKFSSTWRLLSETTVFLSRTKLFPRYENML
FT                   RQWRHRLESSKSNPEVLQEVRDGVITLRKELRRAGYDLTLGSKDIKIEGYRNDAAVREG
FT                   FTRMVMVITDTALYYIAGQENHVQLMDYLDNQLRRMRVINIRQRHYLWYRWRANVLVLS
FT                   GSDTEMKDDFEELKQYVETNKLFMLKQLKKL"
     atgaaagata aaggagtgct tcggcgcctt acaaatgaac ttgcggaaaa attctcatca        60
     acatggagac tcctatcgga aacaaccgta tttctcagca gaaccaagct gtttccccgc       120
     tatgaaaaca tgctcaggca gtggcgacat agactcgaat ccagcaaaag taatccggag       180
     gttcttcagg aagtacgaga cggcgtcatc accctacgga aagaactcag gagagcagga       240
     tatgatctta ccctcggaag caaagatata aagatagaag gatatcgaaa tgatgccgcc       300
     gtacgagaag gctttacccg gatggtaatg gtcataacgg atactgctct ctattatatt       360
     gccgggcagg aaaatcatgt tcaattaatg gattacctcg ataaccagct tcggcgcatg       420
     cgggtgatca atattcgtca acgccactat ctctggtacc ggtggcgggc aaatgtattg       480
     gtcctttcgg gctctgatac ggaaatgaaa gatgattttg aggaactgaa gcaatatgta       540
     gagacaaata agctctttat gcttaagcaa ctaaaaaaac tgtaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page