(data stored in ACNUC7421 zone)

EMBL: CP002116.PE48

CP002116.PE48        Location/Qualifiers
FT   CDS_pept        50804..51673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0048"
FT                   /product="metal-dependent hydrolase/oxidoreductase,
FT                   beta-lactamase family"
FT                   /note="COGs: COG1237 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily II; KEGG: tga:TGAM_1342
FT                   metal-dependent hydrolase/oxidoreductase, beta-lactamase
FT                   family; SPTR: Metallo-beta-lactamase domain protein,
FT                   putative; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79208"
FT                   /db_xref="GOA:E1R6S6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S6"
FT                   /protein_id="ADK79208.1"
FT                   /translation="MKELDALTITVVAEDSVGYETPYLGQHGISLFLNAVRGETRVNIL
FT                   MDVGQNPKALLTNMELLNISPGSIDMIVLTHCHYDHTQGLVEIIKATGKRNLPVVAHPD
FT                   LFRVHVITDPFLRYIGVPGEDQNKVVEEAGGVLCLVSDPLELLPGLMTSGEIQMLTDYE
FT                   EVGMALKTIRNGNVSEDSVVDDLSLFAVVRDRGLVVMTGCGHRGIVNIVQQGVRNTGVR
FT                   KIASIIGGFHLIESSDEKIEKTAAGLKALDIDSVKAGHCTGFKAQVELYHAFNDNFSPM
FT                   HAGDIYRF"
     gtgaaagaac ttgatgcatt gacaatcacc gtagttgcgg aggattccgt tggttacgaa        60
     accccttact tggggcagca cggcatttct ctttttctca atgccgttcg aggtgagaca       120
     cgtgtcaaca ttctcatgga tgtcggacaa aatccgaaag cactcttaac aaatatggaa       180
     ttgcttaata tttcacctgg atcaattgat atgatcgttt tgacccactg tcattacgat       240
     cacacccaag gcctcgttga gattatcaaa gcgacgggga aaagaaacct tcctgtcgtt       300
     gcacatcccg atctttttcg cgtacatgtt attaccgacc cttttttgcg ctatatcggc       360
     gtacctggag aggaccaaaa caaagtggtg gaggaagcag ggggagtttt gtgtctcgtt       420
     tccgatccat tggaacttct gccgggcctc atgacgagtg gagagattca gatgcttacc       480
     gactatgaag aggttggtat ggcattgaaa accattcgaa acgggaatgt atcagaagat       540
     tctgtcgttg atgatctgag cctcttcgct gtggtaagag atagagggtt agtcgttatg       600
     acgggctgtg ggcacagagg aattgtgaat attgtccagc aaggggttcg aaataccggc       660
     gttcggaaga ttgcatctat tattgggggg tttcatctca ttgaatcttc cgatgaaaag       720
     atcgaaaaaa cggctgcagg cttgaaggcc ttggatattg attcggtgaa ggccggacac       780
     tgtaccggct ttaaggccca ggttgagctt tatcatgcgt ttaacgataa cttttctccc       840
     atgcacgccg gagatatata ccgattctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page