(data stored in ACNUC7421 zone)

EMBL: CP002116.PE482

CP002116.PE482       Location/Qualifiers
FT   CDS_pept        complement(510348..511619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0495"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR003661:IPR003594:IPR004358:IPR005467; KEGG:
FT                   ank:AnaeK_0446 multi-sensor signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SPTR: Sensor protein; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79642"
FT                   /db_xref="GOA:E1RBB2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB2"
FT                   /protein_id="ADK79642.1"
FT                   /translation="MKQQRFIIPILTTAVALILALGSFGSLIRQSIRHDRLLVESEVGK
FT                   IASFLTEQMLTSSVSDPPPLPDHVRGFALYGSNGHAVIGRGTYPSKLDTTRFISSPHGR
FT                   TSGIPQERWIREKQGSLLLLRALGGAGMNGAGNLQGRGARVGMQSQGRLFLYLDYDTGA
FT                   FLFQSRARVFLLLFGALLFIGASASSWIFYRRVRSYERELEEKKILTELGSAARTLTHE
FT                   LKNPLAVISMQEKILRRQFGKDKDLTASLDIIGEETERISDMIDRVRLLLKQPKGRPEP
FT                   IELVPLLEERSQRLPFPVTIHDNTQARSPRIFCDKTLFVSAVENILRNGREAQGSDTPP
FT                   LSVDISLLRNSVVISFADAGKGIPYDDKEKIFHPFFTTKQNGFGVGLSLVKSFAENAGG
FT                   SIECRNKEAGGTIFRLTFPLYQKG"
     atgaaacagc aacgatttat cataccgata ctaaccaccg ctgtcgccct gatcttggca        60
     cttggaagct ttggctctct cattagacaa agcatacgcc acgacaggct tttggtagaa       120
     tcagaggtcg gaaaaatcgc ttcttttctg acggaacaga tgctcacctc atcggtatcc       180
     gacccaccgc cccttcctga tcatgtgagg gggttcgccc tatacgggag caacggccat       240
     gcagtgatcg gcagggggac atatccatcc aaattggata caacacgctt catctcttcc       300
     ccccacggaa ggacgagcgg aataccgcag gagaggtgga tacgagaaaa acagggatcc       360
     cttctgctcc tccgggccct ggggggagca ggtatgaacg gggcaggcaa tctccagggg       420
     cggggggcaa gagtcggcat gcaatcgcag gggcgtctgt tcctttattt ggattacgac       480
     accggagcct ttctcttcca atccagggcg cgtgtgtttt tgcttctctt cggggccctg       540
     ctttttatcg gcgcatctgc aagcagctgg attttctatc gaagagtacg ttcctatgaa       600
     cgggaactcg aagagaaaaa gatcctcacc gaactagggt ctgcggcaag gaccttgact       660
     cacgaactga aaaaccccct tgcggtcatc agcatgcagg aaaagatcct tcgccgtcag       720
     ttcggcaagg ataaggacct caccgcctcc ctcgatatca tcggagagga gaccgaacga       780
     atttccgata tgatcgatcg agtgcgtctg cttctcaagc agccgaaagg caggccggaa       840
     ccgatagagc tcgttcccct acttgaggaa cgttcacaaa ggctgccctt tcccgttaca       900
     atccatgaca atacacaagc caggtcaccc aggatatttt gcgacaaaac cctttttgtt       960
     tctgccgtag agaatatcct cagaaacggc agggaggctc aaggcagtga cacgccccct      1020
     cttagcgtcg acatatcgct tcttcgcaac agtgtcgtga tctcctttgc agacgctggg      1080
     aaagggattc cctacgacga taaagagaaa attttccatc cctttttcac caccaagcaa      1140
     aacggcttcg gagtgggatt atcgttggta aagagcttcg cggaaaacgc agggggatcg      1200
     atagaatgcc ggaataaaga ggcgggcggg accatctttc gtctcacatt tcccctgtac      1260
     cagaaaggat aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page