(data stored in ACNUC7421 zone)

EMBL: CP002116.PE486

CP002116.PE486       Location/Qualifiers
FT   CDS_pept        complement(513975..514448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:10929 splicing factor,
FT                   arginine/serine-rich 2B; SPTR: Splicing factor,
FT                   arginine/serine-rich 2B"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79646"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB6"
FT                   /protein_id="ADK79646.1"
FT                   /translation="MKLFGKMAIITVGLLFMSVALFANGTREAVPVRGVAGSGSRFAAP
FT                   LEQLNAEGTLVMEDGQYLFRSGGKLYTISAPGYPRSGFLPKEGTTMEVEADLYAPLDIC
FT                   PVANDGHLVVRRATVEGREYELMTASRGFGPSGRGRSGGYGRSGRGYGMYRAN"
     atgaagctat tcggaaaaat ggcaatcatc accgtcgggt tacttttcat gtcggtggca        60
     ctgttcgcaa acggaaccag agaggccgtt cccgtgagag gcgtcgcagg cagcggctca       120
     cgttttgcag ccccactcga gcagctcaac gccgaaggaa ccttggtcat ggaggatggg       180
     caatatttat ttcggtccgg agggaaactc tacacgatta gtgctcccgg ttatccccgt       240
     agtggatttt tacccaaaga aggaacgaca atggaggtag aggctgatct ttatgccccc       300
     cttgatatct gccctgtggc caatgacggt cacctggtag tgcggagagc aacggtagaa       360
     gggagggaat atgaacttat gacagcctct cgcgggtttg gtccatcggg aagaggccga       420
     tccggaggct atggacgaag cggtaggggt tacggaatgt accgggcaaa ctag             474
//

If you have problems or comments...

PBIL Back to PBIL home page