(data stored in ACNUC7421 zone)

EMBL: CP002116.PE49

CP002116.PE49        Location/Qualifiers
FT   CDS_pept        complement(51724..53061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0049"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR004841:IPR002293; KEGG:
FT                   mem:Memar_1826 amino acid permease-associated region; PFAM:
FT                   amino acid permease-associated region; SPTR: Amino acid
FT                   permease-associated region; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79209"
FT                   /db_xref="GOA:E1R6S7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S7"
FT                   /protein_id="ADK79209.1"
FT                   /translation="MSQKGTGLHRELGILDVTAITSGIIIGAGVFIVTGIAAQFAGSLT
FT                   WLAYAIGAIPVILVGISTIFLNLMHPVEGGESYVYPTRIVSKPLGFLSGWGMWLAVIGP
FT                   IAITAQAFINYLNALPGTSVVFPATIGAVVVTILFSLINWVGLKTVKIVQNVLFLFMVA
FT                   GILIYIILALPHMKGTNITMGSPLGFAGVMKATSLLLFSYAGLTLAADLGEEAKNPAKT
FT                   ITWGIILGILIPTLLYVVSAFVSTAVLPWKDFAASEAPYAAVASTFMGPFGVVFIVIVA
FT                   WAAILSSHNGEQAVAARVFFGLSRDGILGGKTASVNRFGTPTFGLIATSVLAIILIISG
FT                   TIQLVAEIIVAMFLYNWIITHIAVLMARKKFPELVDKLPGIYRKKGFLCLPVLGLAVSV
FT                   YLLILQGWKALLYAAVWMIVGYLVYLVGISRNKKEILSRMDRWPES"
     atgtctcaaa aaggaaccgg gctccacagg gagcttggca ttctagatgt aacggcaatt        60
     acatcgggta ttatcatcgg tgccggtgta tttatcgtta ccggaatagc ggctcaattc       120
     gcgggttcgc tcacctggct cgcctatgca ataggtgcca tccctgttat tctcgtcggt       180
     ataagcacaa tatttcttaa ccttatgcat ccggtggaag gcggagagag ttatgtgtat       240
     ccaaccagaa tcgtttcgaa gcctcttggc tttttatcag gttgggggat gtggcttgcc       300
     gttatcggtc cgattgcaat tacagcacaa gccttcatta attacctaaa cgcccttccc       360
     ggaacatcgg tagtctttcc tgcgactatt ggtgcggttg tagttacaat actattttcc       420
     ctcatcaatt gggtcggctt aaaaaccgtt aaaatcgtac agaatgttct tttccttttt       480
     atggtcgcgg gaatactcat atatataatt ctagcccttc cccatatgaa gggaacaaat       540
     atcacaatgg gatcacccct gggttttgcc ggagtcatga aggccacatc gttgctcctt       600
     ttttcctatg caggattgac cttggcagca gatcttgggg aagaagcaaa gaatcccgca       660
     aaaaccatta cctggggaat tattctaggg attttaattc ccacacttct ctatgttgta       720
     tcggcattcg tttcaacagc agtgcttccc tggaaggact ttgcagcatc tgaggccccc       780
     tatgctgcgg tagcttctac cttcatgggg cctttcggtg tcgtctttat cgttattgtt       840
     gcatgggcag cgattttgtc atcacataac ggtgagcagg cagtagcggc gcgggtgttt       900
     ttcggactgt cccgagatgg aatcttggga ggaaaaaccg catcggtaaa tagattcggg       960
     acaccgactt tcggactcat tgctacatcg gtacttgcca ttatcttgat tatttccgga      1020
     acgattcagc ttgtcgccga aattattgta gcgatgttcc tttataattg gattatcaca      1080
     cacattgctg tcctgatggc aagaaaaaaa ttcccggaat tagtcgacaa gctccctggg      1140
     atatacagga aaaaaggatt tctgtgtctt cctgtacttg gactggctgt ttcggtctat      1200
     ctcttgatcc ttcagggctg gaaggctctc ctgtatgcgg ccgtctggat gatagtcggc      1260
     tatctggtct atttagtagg gatcagcaga aataaaaaag aaattctttc ccgtatggac      1320
     agatggcctg aatcatag                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page