(data stored in ACNUC7421 zone)

EMBL: CP002116.PE498

CP002116.PE498       Location/Qualifiers
FT   CDS_pept        528692..530179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0512"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: afn:Acfer_1102 protein of unknown
FT                   function DUF112 transmembrane; PFAM: protein of unknown
FT                   function DUF112 transmembrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: Tripartite tricarboxylate
FT                   transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79658"
FT                   /db_xref="GOA:E1RBC8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC8"
FT                   /protein_id="ADK79658.1"
FT                   /translation="MILQSFLAVVSPVCFLWILLGTVVGIIFGAIPGLTATMAIVMFIP
FT                   VTYSLPPVVSIALLMSLYIGGISGGLIPAILLNIPGTPASIATCFDGRPMAVNGEGGKA
FT                   LGYGVVFSFFGTVLSVLALVLISPLLAALAIKFGPFEYSAVTIFSLSLIITLSAENLVK
FT                   GLITGIIGLIFATVGMAPIDSVTRYTFGTVNLRSGFDILTVLVGIYAIPEILAAAENSR
FT                   MLNKIDTSAIGKVSIRGFGFSFKDFVGQIWNATRSALIGIGLGILPGIGNGTSNILAYS
FT                   VAKNQSKHPEKFGTGIPDGIVATESANNATIGGTIIPLLTLGIPGDSTAALLLGAFIIN
FT                   GITPGPLIFQQNGNIVYAVYFAMILASIAMLLFELFGINLFVKILQIPKHLLFPIVFIL
FT                   CAIGAFGLNNRLFDVYVLICFGIVGYFLKKSDYPLPPLILGFVLGPIFELNFRRALSYS
FT                   QGSFLPFLTQPIALAFLVLTIVSVGFGISKRRRRGAF"
     atgattctac aaagctttct ggcggtggta tctcccgtct gtttcctttg gattcttctt        60
     gggacggtcg taggaatcat cttcggggcc attcccggac tgactgccac tatggccatc       120
     gttatgttta ttcctgtgac ctacagcctt ccgcctgttg tcagtattgc cttgttgatg       180
     tccctttata tcggtggaat ctcgggtggt ttgattcctg cgatcctttt gaacatcccc       240
     ggtaccccgg cttccatcgc aacctgtttc gatggaagac ctatggcggt caatggggaa       300
     ggaggtaagg cgcttggata tggggttgtg ttcagttttt tcggtactgt attgagtgtc       360
     ctggcattgg tgttgatatc tccgttactt gctgcattag ccatcaaatt tggaccattc       420
     gaatactctg cggtgacaat tttctccctt tctctgatca tcaccttgtc tgcggaaaac       480
     ttggtgaaag ggcttatcac cggtatcatt ggactgatct ttgcaacggt tgggatggcg       540
     cccatcgatt cagtaacacg gtatacgttc ggtacggtga atctccgatc aggatttgac       600
     atcttgactg tattggtcgg catctatgcg atccctgaaa ttcttgctgc agcagaaaac       660
     agcaggatgt tgaataagat tgataccagt gcgatcggta aggtgagtat ccgcggattc       720
     ggcttttcct tcaaagactt tgttgggcag atctggaatg ccacccgcag tgcacttatc       780
     ggcataggat tagggattct gccgggaatc gggaacggaa catccaatat tcttgcatat       840
     tcggtagcga agaaccagtc gaagcatcct gaaaagttcg ggaccggtat tcctgacggt       900
     attgtcgcta cagaatcggc gaacaatgcg accatcggag ggacaatcat tccgttgctg       960
     acgttgggca ttcccggtga ttccacagca gcactgttgt tgggtgcctt cattatcaac      1020
     ggcatcaccc ctggtcccct gattttccaa cagaatggga atatcgttta tgcggtctat      1080
     tttgccatga ttcttgcaag catcgccatg ttgctctttg agttgtttgg aatcaacctg      1140
     tttgtaaaga tcttgcagat ccccaaacat ctgctgttcc cgatcgtatt tatcctgtgc      1200
     gcgataggtg ccttcggctt gaacaaccgg ctttttgatg tctatgtact gatttgtttt      1260
     ggcatcgtcg gatactttct gaaaaagtca gattatccct tgcccccgtt gatccttgga      1320
     tttgtgcttg gcccgatatt cgaattgaat tttagaaggg ctttgtcgta ctcgcaggga      1380
     agttttctgc ccttcctcac acaacctatt gcactggcct tcctggtact gaccattgtt      1440
     tctgtggggt tcgggatttc aaagagacgg agacggggcg ccttttaa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page