(data stored in ACNUC7421 zone)

EMBL: CP002116.PE5

CP002116.PE5         Location/Qualifiers
FT   CDS_pept        3965..4435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: vpr:Vpar_0005 protein of
FT                   unknown function DUF721; PFAM: protein of unknown function
FT                   DUF721; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79165"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N3"
FT                   /protein_id="ADK79165.1"
FT                   /translation="MKKASEILSQFFDQAQLEKAQKYSSFFRSWRTIVGIDIASHTRVR
FT                   EIERDVLIVEADHPGWAQMIELKKRRILRDINKKYPEFSLSNIRVWIVQQLGAVYPVER
FT                   EEGNRNEWHYEPPVFGEKEKNERKSAGDDGRLQQMLDSIGKMVKGSERDNRH"
     atgaaaaagg catcggagat tctgtctcag ttttttgatc aggcacagtt ggaaaaggcc        60
     cagaaataca gctctttttt ccgtagttgg agaacaattg tcggtatcga tattgcaagt       120
     catactcggg taagggagat agagcgggat gttttaattg tggaggcaga tcatccgggt       180
     tgggctcaga tgatagaatt gaaaaaacga cgaatccttc gggatatcaa caaaaagtat       240
     ccggaatttt ctttgagtaa tattagggta tggattgtac agcaattagg ggctgtctat       300
     ccggtagaac gagaagaggg caataggaat gagtggcact atgagcctcc cgtttttggt       360
     gaaaaagaaa aaaacgagag aaaaagtgcc ggtgatgacg gccgtttaca gcagatgctc       420
     gatagtattg ggaagatggt taagggttct gagagggata atcgccattg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page