(data stored in ACNUC7421 zone)

EMBL: CP002116.PE50

CP002116.PE50        Location/Qualifiers
FT   CDS_pept        complement(53132..55048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0050"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR006638:IPR013704:IPR007197; KEGG: cth:Cthe_1094
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Radical SAM-like protein; PFAM: Domain
FT                   of unknown function (DUF3362); Radical SAM superfamily;
FT                   Radical SAM N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79210"
FT                   /db_xref="GOA:E1R6S8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S8"
FT                   /protein_id="ADK79210.1"
FT                   /translation="MTPVYSIGFLLYSSAMHKNHAEFLPLTKQEFEAQHGTASPDFIIV
FT                   SGDAYVDHPSFGTALIGRLLESRGYRVAIIAQPDWRNTEDFSRFGRPRLAFLVTSGNLD
FT                   SMVANYSASRHPRREDAYSPGGKAGLRPDRSLVVYTSRIRQAFKGVTVALGGLEASLRS
FT                   LSHYDYWSDTIRRSVLLDAKADYLLYGMSETTILALAAALETAVEKGSQPNVETIRGLV
FT                   RVVGKNNIAYDNIISSQYDDITGSKTVFLPSHEALIKDGTRYADHFALQMKHADPYSAA
FT                   TLIEPCGDRFIVHNPPPFPLTTEELDAVYELPFCRRAHPSYAKAGGIPALQEVRFSLVS
FT                   SRGCFGGCSFCALTFHQGRIITPRSKESLLREAQKLIADPDFKGYIHDVGGPTANFHTP
FT                   ACEGQKHRGACSNRQCLFPKPCPSLKVDHTAYLDVLKSLRKLPGVKKVFIRSGIRFDYL
FT                   LLDENRSFLKELVAYHISGQLKVAPEHAGSRTLEAMGKPPIEVYEQFSRLFYEETKRIG
FT                   KKQYLIPYLIAGHPGSTLDEAVELALFLKKSGFIPDQVQDFYPTPGTLSTCMWATGIDP
FT                   RTMKPIFVPRGEKERHLQRALLQFNRPKNYDRVRKALRQAGRSDLIGFGQTALVPPERN
FT                   RHP"
     gtgacccctg tttatagcat cggctttctt ctatactcaa gtgcaatgca caagaaccac        60
     gccgaattcc tgcccctcac aaagcaggaa ttcgaggcac agcacggaac agcgtccccc       120
     gatttcatca tcgtttccgg ggatgcctat gtcgatcatc cctcctttgg aacagccctt       180
     atcggccgcc tcctggaaag ccgcggctat cgtgttgcga tcatagctca gccggactgg       240
     aggaacacag aggatttcag tcgtttcggg aggcctcgtc ttgcctttct ggtcacctcc       300
     ggaaatcttg actcaatggt cgcaaactac agtgcatcac ggcaccccag aagagaggac       360
     gcctactcgc ccggcggcaa agccggtctg cgtcccgacc ggagtctggt agtctatacc       420
     agccggatca ggcaggcctt taaaggggtt accgtcgcac tcggcgggct tgaggcctcc       480
     ctcagaagtc taagccacta cgactactgg agcgatacga ttcggcgttc ggttctcctc       540
     gatgctaagg ccgactatct tctctacggg atgtcggaaa ctacgatact tgccctggcg       600
     gctgcattag agacggctgt cgaaaaagga agccagccca atgtggaaac gattcgcggt       660
     ttggttcggg tcgtcggaaa aaataatatt gcatatgaca atatcatatc atcacaatat       720
     gatgatatca caggatcaaa aactgttttc ttgccctctc acgaggcact catcaaggat       780
     ggcacacgtt atgccgacca ttttgcactc cagatgaaac atgccgatcc ctacagcgcc       840
     gcaaccctta tagagccctg cggtgatcgc ttcatagtcc acaatcctcc tccctttccc       900
     ctcacaacgg aggaacttga tgcggtctac gaactaccct tttgccgaag ggcccacccc       960
     tcctatgcaa aggccggagg cattcctgcg ctccaggagg tacgcttctc ccttgtcagc      1020
     agccgggggt gtttcggggg ctgcagtttc tgcgcgctca cctttcatca gggacggatc      1080
     attacgcccc gaagcaagga aagccttctt cgggaagccc aaaagcttat agccgatccc      1140
     gatttcaaag gctacatcca cgatgtcggc ggtcccaccg caaattttca cacacctgct      1200
     tgcgaggggc aaaaacatcg aggtgcctgt agcaaccggc agtgcctctt tcccaaaccc      1260
     tgcccatctc tcaaggtcga tcatacggcc tacctcgatg tactcaaaag tctgaggaag      1320
     ctccccggcg taaaaaaggt gttcatccga agcggtattc gtttcgacta tctcctgctg      1380
     gatgaaaata gaagtttctt aaaggaactg gtggcatatc acatcagcgg gcagctcaag      1440
     gttgctcccg aacatgccgg atcgcgaacc ctcgaagcca tgggaaagcc accgatagag      1500
     gtatatgaac aattctcccg ccttttttac gaagaaacga agcggatagg caagaagcaa      1560
     tacctcattc cctacctgat cgccggccat cccggaagta ccctcgatga agcggttgag      1620
     ttggctcttt tcctgaaaaa aagcggtttt attcccgacc aggtacaaga tttctacccc      1680
     accccgggaa ccctatccac ctgcatgtgg gctaccggca tcgatcccag aaccatgaaa      1740
     ccgatcttcg tcccgcgagg tgaaaaagaa cggcatcttc aacgcgccct gcttcaattc      1800
     aacagaccga aaaactacga cagggttcgc aaagccctta gacaggcagg taggagtgat      1860
     ttgatcggat ttggtcagac agctttggtc cctccggaaa gaaaccgaca cccgtaa         1917
//

If you have problems or comments...

PBIL Back to PBIL home page