(data stored in ACNUC7421 zone)

EMBL: CP002116.PE508

CP002116.PE508       Location/Qualifiers
FT   CDS_pept        complement(540628..541689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0522"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: tpp:TPASS_0981 possible sensory transduction
FT                   histidine kinase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein; SPTR: Sensory
FT                   transduction histidine kinase, putative; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79668"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD8"
FT                   /protein_id="ADK79668.1"
FT                   /translation="MTEAQNQPKSNEELEKELFDIRQLLEISKSLSSQLDLSSLLDSIL
FT                   YICMGQMRVTQAALFARNDLDSKSLRLTRNQEGFLLDHNRDYQISIDDPLSFQFLHEPR
FT                   CYTLEESRSLCPSAPALQIIGLLSPTLLIPLIARGHLTGIILLGERIQGGLYTPKEERY
FT                   LLDISRLASSALYNAILFEMSTTDMMTHLRFRHYFTTVVSDKLMEKGDFYSFSIIMLDI
FT                   DHFKKVNDTYGHTAGDEVIKSVSRIIRDNLRQQDMGVRYGGEEFLVFLEEVPETTAYDI
FT                   AERLRKKVGTCHEELMACSEQVTISAGVAHYRPSVDKNIEACIHRADVALYYSKRNGRN
FT                   RTTCASEIEQLEQ"
     atgaccgaag cacagaatca gccgaaaagc aatgaagaac tagaaaaaga actctttgat        60
     atccgacagc ttttggaaat tagtaaaagc ctcagcagcc agcttgatct ctcaagcctt       120
     cttgattcga ttctttatat ctgcatgggc caaatgaggg tcacacaggc cgctcttttt       180
     gcaagaaacg atcttgactc gaaaagttta cgattgacaa gaaatcagga gggtttcctc       240
     ctcgaccata acagggatta tcagattagc atcgatgatc ctcttagctt tcaatttctt       300
     cacgaaccgc gctgttatac cctggaagag agcaggagcc tctgcccttc tgcaccagca       360
     ttacagataa tcggccttct ctccccgact cttttgatcc ccctcatcgc aagaggccac       420
     cttaccggta tcattttgct tggagaacgc atccagggag ggctttatac cccaaaagag       480
     gaacgttacc tcctggacat ttcaaggtta gcctcttccg ccctttacaa tgcgatcctt       540
     tttgaaatgt ctaccaccga tatgatgacc caccttagat tcaggcatta cttcaccacc       600
     gtcgtctctg ataaactcat ggaaaagggt gatttctatt cattctccat cataatgttg       660
     gatatcgatc attttaagaa ggttaacgac acctacggcc atacggcagg agacgaggta       720
     atcaaaagcg tgagcagaat catacgagac aatctccgcc agcaggatat gggggtacgc       780
     tacgggggcg aagagtttct tgtttttctg gaagaggttc ccgaaacgac agcctacgac       840
     attgccgaaa ggctgagaaa aaaggtgggg acctgccacg aggagcttat ggcatgtagc       900
     gaacaagtaa caatctctgc aggggtggcc cactatcgtc catccgtgga taaaaacatc       960
     gaagcctgca tccatagagc ggatgttgct ctctattact caaaacggaa cggaagaaat      1020
     cgaacaacct gtgccagcga gattgaacaa cttgagcaat ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page