(data stored in ACNUC7421 zone)

EMBL: CP002116.PE51

CP002116.PE51        Location/Qualifiers
FT   CDS_pept        complement(55045..55689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0051"
FT                   /product="deoxynucleoside kinase"
FT                   /note="COGs: COG1428 Deoxynucleoside kinase; InterPro
FT                   IPR002624; KEGG: dge:Dgeo_0101 deoxynucleoside kinase;
FT                   PFAM: deoxynucleoside kinase; SPTR: Deoxynucleoside kinase;
FT                   PFAM: Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79211"
FT                   /db_xref="GOA:E1R6S9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S9"
FT                   /protein_id="ADK79211.1"
FT                   /translation="MKKYVVLAGNIGAGKSTLVRKLADRLGFRPYYEPVTENPYLKDFY
FT                   SDMRRWAFHSQTFFLTHRVRTHHLLAEDPFSVVQDRSMYEDAEVFARNLYEQQSMTKRD
FT                   WETYQELYHTLITMLPPPDLIVYLRASVTTLKKRIALRGRNFEASISDTYLQGLNRLYD
FT                   RWTNDFTLAPILIVPTDRLDFVEQNKDFEAIVKTIEQRLLDKQGILFPVGM"
     atgaaaaaat atgtcgtgct tgcgggaaat atcggtgcgg gaaaatctac cctcgtgaga        60
     aaacttgccg atcggcttgg ctttaggccc tactacgagc cagtgacgga aaacccctac       120
     ctcaaagact tttattcgga tatgagacgc tgggcattcc attcccaaac cttttttctc       180
     acccaccggg tcaggactca tcaccttttg gcagaggatc cgttctctgt ggtgcaggat       240
     cgttccatgt acgaagatgc agaggtcttt gccagaaacc tctacgaaca gcaatctatg       300
     acaaagcgag actgggaaac ctaccaggaa ctgtatcata cccttatcac catgcttccc       360
     ccgcccgacc tgatcgtcta tcttagggca tcggtgacaa ccttaaaaaa acgcattgcc       420
     cttcggggaa ggaatttcga ggcctccatt tccgacacct acctccaagg cttgaatcgg       480
     ctctatgatc ggtggactaa tgatttcact cttgccccga tattgatagt tcccacggat       540
     cgcttggatt ttgtggagca gaacaaagac ttcgaggcca ttgtcaaaac catcgaacag       600
     cgactattgg ataaacaggg aatcctcttt cccgttggta tgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page