(data stored in ACNUC7421 zone)

EMBL: CP002116.PE516

CP002116.PE516       Location/Qualifiers
FT   CDS_pept        547662..548954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0530"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="COGs: COG1301 Na+/H+-dicarboxylate symporter;
FT                   InterPro IPR001991:IPR018107; KEGG: aco:Amico_0277
FT                   sodium:dicarboxylate symporter; PFAM: sodium:dicarboxylate
FT                   symporter; SPTR: Proton/sodium-glutamate symport protein;
FT                   PFAM: Sodium:dicarboxylate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79676"
FT                   /db_xref="GOA:E1RBE6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE6"
FT                   /protein_id="ADK79676.1"
FT                   /translation="MSAQEKKGVMDWYFKSNLLVRILIGLVLGAIAGIIFGSSILWIAP
FT                   FGDLFVRLLKMIVMPVIFATLVVGAASISPARLGKVGIKIVLFYLLTSAFAVAIGLIFG
FT                   NLFHPGTGLDLASVANASGRELVKPSLTSTLLNIVPTNPFSAIAGGDVLPTIFFAIIFG
FT                   IGISYLKISENDRIKQAGDVLFRVFDGAAEVMYMVVRWVLQYAPVGVFALIAVVFAKQG
FT                   AAAVGPLGKVTLAVYIALIVHVFLVYGGLLTANKLNLFHFLSGAKEAMLTAFVTRSSSG
FT                   TLPVTMKCSEENHGVDRNIYSFTLPLGATINMDGTAIYQGVCALFIGFAIGLPLNFTQQ
FT                   ITIIITAVLASIGTAGVPGAGAIMLLMVMDSVGLPITEGSPVAAAYAMILGIDAILDMG
FT                   RTCINVTGDMTGTLLIAKSEKQVDMSKWQKK"
     atgagcgcac aggaaaaaaa gggcgtaatg gactggtatt ttaaatcaaa tcttctggtg        60
     aggatcttga ttggcctagt ccttggtgcc attgccggga tcattttcgg ctcatcaatt       120
     ctctggatcg ctcctttcgg tgatctgttt gtcaggcttc ttaagatgat cgtgatgccg       180
     gtaatctttg ccaccctggt tgtgggggcg gccagtatca gtcctgctcg gctcgggaag       240
     gtcggtatca agattgtact gttttatcta ctgacttcag cctttgccgt ggccatcggt       300
     cttattttcg ggaacctttt tcatcctggt accggacttg atcttgcttc ggtagccaat       360
     gcctctggac gtgagcttgt gaagccttca ctgacttcga cactgcttaa tattgttccc       420
     accaatccct tcagcgccat tgccggaggc gatgtgcttc ctacgatctt ctttgccatt       480
     atcttcggta tcgggatcag ctatctgaaa atcagcgaga acgacagaat caagcaggct       540
     ggtgatgttc tgttccgcgt ctttgacgga gccgccgagg ttatgtacat ggttgttcgc       600
     tgggtgttgc agtatgcccc cgtcggagtc tttgccttga tagccgtagt tttcgccaaa       660
     cagggagccg ctgcggtcgg ccctcttgga aaggtcaccc ttgccgtcta tatcgccttg       720
     attgtgcatg tcttcttggt gtatggcggc ctgctcacgg caaacaaact taaccttttt       780
     catttcctct ccggggccaa agaggcgatg ttgaccgcct ttgtcacccg ttcttccagc       840
     ggcaccctgc cggtaaccat gaagtgcagt gaggaaaacc atggggttga ccgaaatatt       900
     tactccttta ccctcccgct tggtgctacc atcaacatgg acggtactgc catctatcag       960
     ggggtctgtg cgctttttat cggttttgcc atcggcttac cgctgaattt tacccagcag      1020
     attaccatta tcattaccgc tgtacttgca tcgatcggta cggcaggtgt tcccggagcc      1080
     ggtgccatca tgcttttgat ggtcatggat tcggtcggtc ttcccattac cgagggaagt      1140
     cccgttgccg ccgcatatgc catgatcctt ggaatcgatg ccattcttga tatgggcagg      1200
     acctgtatca acgtcaccgg cgatatgacc ggaaccttac taatcgccaa aagcgagaaa      1260
     caagttgata tgagtaaatg gcagaaaaag tag                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page