(data stored in ACNUC7421 zone)

EMBL: CP002116.PE519

CP002116.PE519       Location/Qualifiers
FT   CDS_pept        complement(551553..552404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0533"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="COGs: COG1814 Uncharacterized membrane protein;
FT                   InterPro IPR003251:IPR008217; KEGG: hor:Hore_01890
FT                   uncharacterized membrane protein; PFAM: protein of unknown
FT                   function DUF125 transmembrane; Rubrerythrin; SPTR:
FT                   Uncharacterized membrane protein; PFAM: Rubrerythrin; VIT
FT                   family; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79679"
FT                   /db_xref="GOA:E1RBE9"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE9"
FT                   /protein_id="ADK79679.1"
FT                   /translation="MDMIAEMQRNEITEYQVYRKIAKREKDPENQKVLLRIAEEEKRHH
FT                   DIWARYTGGNAKPKRFKVWFFPFLARLLGLTFAVKLMELGESSAAQAYTKLAETVPEAK
FT                   GIVDDEERHEAELLRLLNEQRLEYVGSIVLGLNDALVELTGALAGLTFAFRNGSMIAAA
FT                   GLITGIAASFSMAASEYLSNQSEGNHEKALTSAVYTGIAYIVTVTLLILPFFIFSNSYV
FT                   SLGVTLLVAALIILGFTFYISVAKELPFRRRFLEMISLSFGVAAISFALAALVRTVFGI
FT                   DA"
     atggacatga tagccgagat gcagcgaaat gagatcaccg aatatcaggt ttaccgaaaa        60
     attgcaaagc gagagaagga tccggagaac caaaaggtgc tcctgcggat cgccgaagaa       120
     gaaaagcgcc atcatgatat ctgggcacga tatacaggag gcaatgcaaa gccgaaacgg       180
     tttaaggtct ggttttttcc cttcttggcg aggctgctcg gtcttacctt tgcggtaaaa       240
     ctaatggaac ttggcgaatc ttccgctgcc caggcgtaca ccaagctggc agaaacggtt       300
     cctgaggcaa agggcattgt cgacgatgaa gagcgacacg aagcagaact gttacggctc       360
     ttgaacgagc agagactgga atatgtcggc tctatcgtgt tgggactgaa tgatgcattg       420
     gtcgaactga ccggggcttt ggccggcctt accttcgcct ttcgaaacgg aagcatgatt       480
     gcagctgcag ggctcattac cggaattgcc gcttcctttt caatggcggc aagcgaatat       540
     ctttccaatc aatccgaagg taatcatgaa aaggcattaa cctctgccgt ttatacaggt       600
     atcgcctata ttgtgacagt gaccctgctg attctcccct ttttcatctt ctcgaacagc       660
     tatgtaagtc ttggtgtaac cctgctggtt gcggcactca ttattctcgg ctttaccttc       720
     tacatctcgg tggcaaagga gcttccattc cgacgccgct ttcttgagat gatctcttta       780
     agttttggtg ttgccgctat tagttttgcc ctggccgcac tggtaagaac ggtcttcggc       840
     atagatgctt ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page