(data stored in ACNUC7421 zone)

EMBL: CP002116.PE52

CP002116.PE52        Location/Qualifiers
FT   CDS_pept        complement(55750..56901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0052"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000524:IPR001761; KEGG: aca:ACP_0022 transcriptional
FT                   regulator, GntR family; PFAM: regulatory protein GntR HTH;
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   SMART: regulatory protein GntR HTH; SPTR: Transcriptional
FT                   regulator, GntR family; PFAM: Bacterial regulatory
FT                   proteins, gntR family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79212"
FT                   /db_xref="GOA:E1R6T0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T0"
FT                   /protein_id="ADK79212.1"
FT                   /translation="MTNKVERMQFKYQYIYDKLRNLLENGRYHAGDRLPTEVELASRFN
FT                   VSRPTVTRALNALQEEGIIVRKTGSGSFVNNLHSYKNKFNNRIFGLLVPGLGKGEIFEP
FT                   ICTQIAANAEKNQCSLLWSGSEIRTTEAAKSLVDVTQRYIAHHIAGVFFEPLELSPSFD
FT                   QINRKIISMFQDAGIPIVLIDSDYLPFPERSNLDLVGIDNFRAAYMATRHYLRHGEKRI
FT                   DFLARPYSAYTISIRLRGYRTALIDYGIIPQAEWIHLVNPEELEYITSRFDHPEAPPFN
FT                   MICANDETASALLGACESVGISVPEHLRIVGFDDVHYAQMLRVPLTTIHQSVQQIGNLA
FT                   LETLLWRIEHPDAPARTINAETRMIIRESCGMTGKAEISPFYS"
     gtgacaaaca aagttgagcg catgcagttc aaatatcagt atatctatga taaacttcga        60
     aatcttcttg aaaacggtag atatcatgcc ggtgaccgct tgccgacaga agttgaactg       120
     gcctcacgct ttaatgtctc ccggccaaca gtcacccgtg cgttgaacgc tcttcaggaa       180
     gagggcatca ttgttcgaaa aacaggatcc ggaagtttcg ttaacaacct tcattcctac       240
     aaaaataaat tcaacaaccg catttttggg ctcttggtcc ctggccttgg taaaggagag       300
     attttcgaac caatttgtac gcaaattgct gccaatgcgg agaaaaatca atgctcactt       360
     ctctggagtg gttcggaaat cagaacaacg gaagcagcaa agagtttagt cgatgttacg       420
     caacgctata ttgcccacca catcgcaggc gtcttcttcg aacccctgga attgagcccc       480
     tctttcgatc agatcaatcg gaaaatcata tcaatgtttc aggatgccgg gattcctatt       540
     gtcctgatcg actcggatta tctccccttc ccggaacgaa gcaatcttga tctcgtgggc       600
     atcgataatt ttcgtgcggc atatatggca acccgccatt atctcaggca tggagaaaaa       660
     cggatcgatt tcctcgctcg tccatactcc gcgtatacca tttcaatcag attgaggggc       720
     tatcgtaccg ctctcatcga ttatggaatt atacctcaag cagaatggat ccacctggtc       780
     aatcctgagg aactcgaata tattacctct cgtttcgacc atcccgaagc cccccccttc       840
     aatatgattt gcgccaatga cgaaacggcc tcggcgcttt taggcgcgtg cgaatccgtc       900
     ggtatttctg ttccggaaca tctcaggata gtaggatttg acgatgtaca ttacgctcaa       960
     atgctgagag ttcccctcac aaccattcat caatccgtac aacaaattgg taacttagcc      1020
     ttggaaaccc tcctctggag gatcgaacat ccggatgccc cggcccgaac tattaatgcc      1080
     gaaacaagaa tgatcatccg agaatcctgc ggcatgacag ggaaggcgga aatttctccc      1140
     ttctacagct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page