(data stored in ACNUC7421 zone)

EMBL: CP002116.PE521

CP002116.PE521       Location/Qualifiers
FT   CDS_pept        555701..556717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0535"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG2334 Putative homoserine kinase type II
FT                   (protein kinase fold); InterPro IPR002575; KEGG: dps:DP2064
FT                   hypothetical protein; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: Aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79681"
FT                   /db_xref="GOA:E1RBF1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF1"
FT                   /protein_id="ADK79681.1"
FT                   /translation="MENEKPPAGIFDYIEPDGIISAVEISYGINLDGTWSAFPSYVNRV
FT                   YGLRDEDGNRYVVKLYRPGRWSVSAIEEEHGFLLECAAEEVPVVAPLSGVDGRTLHFLE
FT                   CPAISGSYPFALFPLRSGRLFETDRDEDYLRIGSLIGRLHRISRQGKAHVRQEWLPSLS
FT                   KNHLEMLLEQNLVSSSLRRHFEGLCLHCIETIEPLFSHQPLLRLHGDCHRGNILERPGE
FT                   GLMLIDFDDMSNGPAVQDLWLLLPDRIGACEYQFSLLQEGYGQFSALSPGSALLIEPLR
FT                   FMRMLHYLAWTAHQQCDHDFSLRHPQWGSEAFWIRELADFEEQFDYIRKILDSSYTG"
     atggagaatg agaaaccccc agctggtatc tttgactata ttgagcctga cggaatcatc        60
     tctgctgttg agatctctta cggcattaat ctggacggta cgtggagtgc gtttcccagc       120
     tatgtaaatc gcgtatacgg acttcgggat gaagatggta atcggtatgt ggtgaaactg       180
     tatcgtccgg ggcgctggtc cgtttcggcg atagaggaag aacacggctt tttgctggag       240
     tgtgccgcag aagaggtccc cgtcgttgca cctctttcgg gagtagatgg aaggacgctt       300
     cattttctgg agtgtcccgc catatcaggt tcctatccct ttgctctttt ccctcttcgg       360
     tcgggacgac ttttcgaaac ggatcgtgat gaagattatc tgcgtatcgg ctctctgatc       420
     gggcgtcttc atcgaatttc ccgccagggg aaagctcacg tcaggcagga atggcttccc       480
     tcacttagca agaatcacct tgagatgctg cttgagcaaa acctggtttc ttcttctttg       540
     cgtcggcatt tcgagggatt atgtctccac tgcattgaaa caatcgaacc gcttttctct       600
     catcagcccc ttttgcgtct tcatggcgac tgccatagag gtaatatcct ggaacggccg       660
     ggagaaggct tgatgcttat cgattttgac gatatgtcaa acggcccggc ggtacaggac       720
     ctttggttgt tgcttcccga tcggattggg gcctgtgaat atcagttttc gcttttgcag       780
     gaaggctacg gccaattttc ggccctttcc cctggttccg cgcttctcat agaacccctg       840
     cgctttatgc gaatgcttca ctatctcgca tggaccgccc atcagcaatg cgaccatgat       900
     ttttccctgc gtcacccaca gtgggggagc gaggcgtttt ggattcgaga gcttgcggat       960
     tttgaagagc aattcgacta tatccgaaag attctcgatt cttcttacac cggatag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page