(data stored in ACNUC7421 zone)

EMBL: CP002116.PE526

CP002116.PE526       Location/Qualifiers
FT   CDS_pept        560751..561938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0541"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011495:IPR005467; KEGG: mth:MTH985
FT                   sensory transduction histidine kinase; PFAM: histidine
FT                   kinase dimerisation/phosphoacceptor; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Sensory transduction histidine
FT                   kinase; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79686"
FT                   /db_xref="GOA:E1RBF6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF6"
FT                   /protein_id="ADK79686.1"
FT                   /translation="MKNLNQKNCGSVCSRADFFASLAVRYLQFPLGEIDYQQVGHDLVS
FT                   LSGAQSVFLNLYVADKHCIETKAFASSLTGGAVPSCGPSFVGRSWPMDDAVGKTFRSSE
FT                   LTSINAETGGGLDTMVHSLFSRFGEVGLWALGLLHDGRFLGNFFMVFEKEEQKPDRKGI
FT                   DAFTEIVVRLLLRKEKERQLQQNLTEKDLILRESHHRIKNNLSLISSLVALQGELLSPE
FT                   LASLLYPIISRINAIVLIHEQLHEAGSDGKQVRFETYVRRLVGELADSFRSDDSGITLS
FT                   ILRADHAFFEDGTAIPLGIILTELVMNSFKHAFKGLPGGRIDVSFMCEDQTAQLIVQDD
FT                   GRGMVSSDIPKQNSAGASLGLVLVESLTAQLQGHWEQSIGENGRGLKNTVAFPLP"
     atgaaaaacc ttaatcagaa aaactgtgga tctgtttgtt cacgggcgga tttttttgct        60
     tcgcttgcgg tacgatatct tcaatttccc ttaggggaga tcgactatca acaagtaggt       120
     catgatcttg tctctctttc aggtgctcaa tctgtcttcc tcaatctcta tgtggcagat       180
     aaacattgta ttgaaaccaa ggccttcgct tcctccctta cagggggtgc ggtgccttct       240
     tgcggcccct cttttgtcgg ccgatcttgg cctatggatg atgcggttgg caagactttt       300
     cgaagctccg aactcacctc tattaatgcc gaaaccggtg gagggctgga taccatggtt       360
     catagtctgt tttcccgttt cggggaagtc ggattatggg ctctcggcct gctccatgat       420
     ggacggtttt tgggaaattt cttcatggtg tttgagaaag aggagcagaa gccggatcga       480
     aagggtatcg acgcctttac cgagattgtg gttcgactgc tgctgcgaaa agagaaggag       540
     cggcaattgc agcagaacct tacggagaaa gatctgatcc tcagggaatc ccatcatcgc       600
     attaagaata atctttcact tatatccagc cttgtcgcct tgcaggggga gctcctttct       660
     cctgagcttg ccagcttgct gtatccgata atcagcagaa tcaatgccat tgtattgatc       720
     cacgagcagc tccacgaggc aggtagcgat ggaaagcagg ttcgttttga aacatatgtg       780
     agacgtctgg tgggagaact tgccgattct tttcgttccg acgactccgg aataacgctg       840
     tcaattcttc gtgccgatca tgcctttttt gaggacggga ccgctattcc ccttggcatt       900
     attttgactg agctggtaat gaattccttt aaacacgcct ttaagggctt gcctggagga       960
     cgaatagatg tttcttttat gtgtgaagac cagaccgccc aattgattgt acaagacgac      1020
     ggtaggggca tggtcagttc ggacatacca aaacaaaaca gcgcaggggc ctcgctcggg      1080
     cttgttttgg tggaatctct gactgcccag cttcaggggc actgggaaca atcgataggc      1140
     gagaacggca ggggattgaa gaataccgtt gctttcccgc taccgtga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page