(data stored in ACNUC7421 zone)

EMBL: CP002116.PE527

CP002116.PE527       Location/Qualifiers
FT   CDS_pept        561961..563157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0542"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="COGs: COG2357 conserved hypothetical protein;
FT                   InterProIPR019734:IPR007685:IPR001440:IPR013105:IPR 013026;
FT                   KEGG: tde:TDE1711 RelA/SpoT domain-containing protein;
FT                   PFAM: RelA/SpoT domain protein; TPR repeat-containing
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SPTR:
FT                   RelA/SpoT domain protein; PFAM: Region found in RelA / SpoT
FT                   proteins; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79687"
FT                   /db_xref="GOA:E1RBF7"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF7"
FT                   /protein_id="ADK79687.1"
FT                   /translation="MDVPIMYPDRKRLEVAYRKRLPCLEQEREDLELQLKNLLQAEEIK
FT                   ATVKGRIKAFDSYYAKLLRKLSSMPMQSLSEQEIDTLIQDLVGVRILTPFLESVTDIER
FT                   LVRSRFSVFEVERKGEEQSFCEFGYRSIHLNIRLDSGQICEIQIRTILQDAWAEVEHEL
FT                   VYKGSFSPFDEPLKRKLAALNATLSLSDIIFQEVRDYQRKLNKELKHRRETFERQIKTE
FT                   LSGTPPLTRMENPPSYENIDDLDQSLLHALQVHNSGDYSGAVVLYGKILAGSLSKEIRV
FT                   ITLMHRGMARFADADYAGAEEDFLAALSSEGHRGKAHYYLGILYRVTGRPGQALNAFSA
FT                   ALEVNPYHFESLLGSARALYDLGDTEEALSYCNNALRLMPDDEAALVLRRTVARKLGL"
     atggatgttc cgattatgta tccggacagg aaacggcttg aggtcgctta tagaaagaga        60
     ttaccttgcc tggaacaaga gcgtgaagat cttgaattac aattgaaaaa cctgcttcag       120
     gcagaagaaa taaaagccac ggtaaagggc cggataaagg ccttcgatag ttattatgca       180
     aaacttcttc gtaaactctc ttcgatgccg atgcagagcc tatccgaaca agagattgat       240
     acgcttattc aggaccttgt cggtgttcgt atcttaaccc cttttcttga gtctgttacg       300
     gatatagaac ggcttgtacg tagccgtttt tcagtctttg aagttgaacg taaaggagag       360
     gaacagagct tttgtgagtt cggctatcgt tccatccatt tgaatatacg tcttgattcc       420
     ggacagattt gtgaaattca gatacgaacg atccttcagg atgcctgggc cgaagttgag       480
     catgaactgg tctataaagg gagcttcagt ccctttgatg agccgttgaa acgtaaactt       540
     gcagccctca atgcgaccct ttcgctttcc gatatcattt tccaagaggt tcgcgattat       600
     caaagaaagc tgaacaagga actcaagcat cggcgggaaa ccttcgaacg ccaaatcaaa       660
     acagagcttt caggaactcc tcctctgacg aggatggaaa atcctccttc ctatgaaaac       720
     atcgatgatt tggatcaatc gcttttacac gctttacagg ttcacaatag tggggattac       780
     agcggggctg tggttctcta cggaaagatc cttgccggct ccttgtctaa ggagatccgg       840
     gttataaccc ttatgcatcg cggcatggcc cgttttgccg atgccgacta cgccggggcc       900
     gaagaggatt ttcttgcggc cctctcttcg gaggggcata ggggaaaagc ccactactac       960
     cttggaattt tataccgggt aacgggtagg ccaggccagg cccttaatgc cttttcagcg      1020
     gctttggagg taaatccata ccacttcgaa tcgttgctgg gctcggctcg ggccctgtat      1080
     gatcttgggg atacagaaga ggctttgagt tactgcaaca acgctttaag gcttatgcct      1140
     gatgacgaag ctgccctcgt attgcggcgg actgtagcta gaaaacttgg actttaa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page