(data stored in ACNUC7421 zone)

EMBL: CP002116.PE53

CP002116.PE53        Location/Qualifiers
FT   CDS_pept        57132..58085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0053"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   eok:G2583_4914 putative periplasmic ribose-binding protein
FT                   of ABC transport system; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; SPTR: Putative
FT                   carbohydrate binding protein; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79213"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T1"
FT                   /protein_id="ADK79213.1"
FT                   /translation="MRKVVLILLCGMLLGGTLFAGGQGEGEKVLQVAATFGDLGNPFFF
FT                   TMGKGVEDAAKAIDPNAKVTVQSSGYDLNTQTSQMENFIANGVDIIILNAADTAGIAPA
FT                   VRKAKEAGIIVVAADVNADGGVDATVTSNNYQAGTQAGEYIVKRLGGKGNIVIINGPPV
FT                   SAVIDRVNGAKEVLAKNPGIKILSDNQNAGGNREGGLRVMTDLLTAYDNIDAVFAINDP
FT                   TGIGADLAIKQAKRGDEMFVVGVDGAPDAVVALNDTNSSFVATPSQDPYTMATRAVQVA
FT                   YEVIQGNPPKEKLILIPTTLITRDNVSEYKGWTEPE"
     atgagaaaag tagtgctgat actgctttgt ggcatgttgc ttggcggaac actgtttgcc        60
     ggtggtcagg gagaaggtga aaaagttctt caggtggcgg ctaccttcgg cgatcttgga       120
     aatcccttct tttttaccat gggtaaggga gtcgaagatg cagcaaaggc aattgatccc       180
     aatgcaaagg tcactgtcca atcgtcgggc tatgatctca atactcaaac cagccagatg       240
     gagaatttca ttgcaaatgg tgtggatatt attatcttga atgcggccga caccgcagga       300
     attgcacctg ccgtacggaa agcaaaagag gctggtatta tcgtggttgc cgccgatgta       360
     aatgcagatg gcggagtcga tgcaacggtt acctccaata attatcaggc cggtacccag       420
     gctggagaat acattgtaaa gaggcttggg gggaagggaa acattgtcat tatcaatgga       480
     cctcctgtat ccgccgttat cgaccgggta aacggagcaa aagaggtttt agccaagaat       540
     cctggaatca agattctctc cgacaaccaa aacgccggtg gtaaccgtga aggcgggctc       600
     cgcgtcatga ccgatcttct taccgcttat gataacattg atgcggtttt tgccattaat       660
     gatccaaccg gtattggtgc tgatttggcg atcaaacagg ctaaacgcgg tgatgaaatg       720
     tttgttgtcg gcgttgatgg tgctcccgat gctgtggttg cgcttaatga cacgaacagc       780
     tcttttgtag ccaccccatc acaggatccg tacaccatgg cgacgagggc cgtgcaggta       840
     gcgtatgaag tgatacaggg gaatccccct aaagaaaaac tgatccttat cccgaccaca       900
     ttgattacca gggacaacgt tagtgaatac aagggctgga ccgaaccgga atag             954
//

If you have problems or comments...

PBIL Back to PBIL home page