(data stored in ACNUC7421 zone)

EMBL: CP002116.PE54

CP002116.PE54        Location/Qualifiers
FT   CDS_pept        58172..59704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0054"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro
FT                   IPR003593:IPR003439:IPR015861:IPR017871; KEGG: ava:Ava_2172
FT                   ABC transporter-like; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Ribose import ATP-binding protein RbsA;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79214"
FT                   /db_xref="GOA:E1R6T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T2"
FT                   /protein_id="ADK79214.1"
FT                   /translation="MDEQDRKEPILSVRNLSKRFPGVQALDGVSLDIYAGEVHVLMGEN
FT                   GAGKSTLMKILAGVYKADEGEIRIDGQLVAPENPLQAMALGVNLINQELGVATNLTVAE
FT                   NVFMGSEPHRFGVIDRHQMAIRTQEVLKKLGASFQPEVRASLLKVAEQQQVDIARALVH
FT                   NGRVLIMDEPTAALSEREIDRLFDLVRSLREQGLAIVYISHRLAEVSVIADRVSVLRDG
FT                   QYIGTVTKDNMDNETIVKMMVGRSLKDFYEHQTAEKKEDNYLVVKHVSDGKRVKDVSFQ
FT                   AAAGEILALSGLVGSGRTELARLIFGADKPLTGEVIVEGRKLTITSPKDAIHQGIGYVP
FT                   EDRKTEGLFLGMSSQENIVMNIMEQKARFGILNRKENGSITDHAIKQLNIKLSNPRNAA
FT                   LSLSGGNQQKLLLARWLQIKPRVLILDEPTRGVDVGAKSEIYKLIGEIAQNGVAVVFIS
FT                   SELPEVVGLAQRVLVMREGRITAELRGPEQINQEIIMAYATGIRKPDYTFSA"
     atggatgaac aagatcgaaa ggaaccgatt ctttccgtcc ggaatctgag taaacgcttt        60
     cccggcgtac aggcactgga cggggtttct ctggatattt atgccggaga agtccatgta       120
     ctcatgggag aaaacggtgc tggaaaaagt acgttgatga agattcttgc cggagtctat       180
     aaggctgacg aaggagaaat tcgtatagac gggcagttgg tcgcccccga aaacccgctt       240
     caggccatgg cacttggggt taacctaatc aatcaggagc ttggcgttgc gacaaatctg       300
     acggtggcgg agaacgtctt tatgggaagc gagccgcatc gttttggggt aatagaccga       360
     caccagatgg ctattcggac tcaggaggtt ttgaaaaaac ttggcgcctc tttccaaccg       420
     gaagtgaggg cttccctgct taaagttgcc gagcagcagc aggttgatat cgctcgtgcc       480
     cttgtacata acggcagagt gctgattatg gatgagccca cagcagcact aagcgagagg       540
     gagatcgaca ggctctttga tcttgtccgc agccttcggg aacagggcct ggccattgtt       600
     tatattagtc accgtctcgc agaggtctcg gtaatagcgg atagggtatc cgttttacga       660
     gacggccaat acatcggaac agtcacgaaa gataatatgg ataatgaaac catcgtaaag       720
     atgatggttg ggcgctcttt aaaggatttc tacgaacatc agaccgccga gaaaaaagaa       780
     gacaactacc tggttgttaa gcatgtgtcg gacggcaaac gggtaaaaga tgtttccttt       840
     caagctgcgg caggtgagat cctagctctc tcggggcttg ttggttcagg acggaccgag       900
     cttgcccgtt tgatattcgg agcggataag ccgttaacgg gcgaagtaat cgtcgaaggg       960
     agaaaactga cgattacttc accaaaggat gcaattcacc agggaatcgg ttacgtgccg      1020
     gaagatcgaa aaacagaggg gctttttctg ggcatgagca gtcaggaaaa catcgttatg      1080
     aatatcatgg agcagaaggc gcgtttcggc atcttaaatc ggaaagaaaa cggctccatc      1140
     accgaccatg caataaagca gctgaacatc aagctttcca acccaagaaa cgcggctctc      1200
     tcgctttcag gagggaatca gcaaaagctc cttctcgccc gttggttaca aatcaaaccg      1260
     agggttttga ttcttgatga accgacccgg ggtgttgatg tgggagccaa aagtgaaatc      1320
     tataagctga tcggagaaat tgcccaaaac ggcgttgccg ttgtttttat ttcaagtgag      1380
     ctgcctgagg tcgtgggcct tgctcaacgg gtgctggtca tgcgcgaagg gcgaatcacc      1440
     gcagaattgc gggggcctga gcagatcaat caggaaatca ttatggcata tgcaacgggc      1500
     attcgaaaac cggactacac tttttctgca tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page