(data stored in ACNUC7421 zone)

EMBL: CP002116.PE55

CP002116.PE55        Location/Qualifiers
FT   CDS_pept        59728..60696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0055"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4158 ABC-type sugar transport system
FT                   permease component; InterPro IPR001851; KEGG:
FT                   npu:Npun_R5324 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79215"
FT                   /db_xref="GOA:E1R6T3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T3"
FT                   /protein_id="ADK79215.1"
FT                   /translation="MSSNNLATKLKQQNSAIWESLGILPILLVIVILFSLLSGNFLRPT
FT                   NLMNILRQASINIVLAAGMTLVILTGGIDLSVGSILASTAVVSLLVSLNPSLQAFTVIA
FT                   PLLTGLLFGVLNGILIAYVKLPFFIVVLGSMTALRGASYLLANGTTLINNDLNFAWIGN
FT                   AYLGPFPWLAIIALAVIAIMWFILRKTVLGVHIYAVGGNPTAARLTGINVSFVLVFVYA
FT                   MSGLLSGLGGIMTASRLYSASGLLGNGYELDAIASVILGGTSISGGSGSVVGTLVGALI
FT                   IAVLNNGLTLMNVSYFWQLVVRGIVIIVAVLIERFRHRKKV"
     atgagttcaa acaatttggc gacaaagtta aagcagcaga attctgcgat ttgggaaagc        60
     ctcggaattc ttccgatttt acttgtgatt gtcattctat tttcactttt aagcggtaat       120
     ttcctgcggc cgacaaatct catgaacatt ctgaggcagg cttcgattaa tatcgtgctt       180
     gcagccggta tgacccttgt tatcttaacc ggcggcattg atttatcagt tggatctatc       240
     ttggcaagta ctgccgtggt cagcctcttg gtatctttga atccctcctt gcaggccttt       300
     acggtcatcg ccccattact tacaggtttg ctttttggtg tgctaaatgg gattttgatt       360
     gcttatgtaa agctaccctt ctttattgtt gtcctgggaa gtatgacagc tcttcgcggg       420
     gcctcgtatc ttttggcgaa tggtaccaca ttgattaaca atgatttgaa tttcgcctgg       480
     atcggtaacg cctatctcgg ccccttcccc tggctggcca ttatagccct cgcggtcatt       540
     gccatcatgt ggtttatcct aagaaaaacc gttctcggtg tacatattta tgccgtagga       600
     ggaaacccaa ctgccgctcg gctaaccggt atcaacgtaa gttttgtcct tgtttttgtg       660
     tatgccatga gcggcctgct ttccggactt ggtgggatca tgaccgccag ccgtctttac       720
     agtgcatccg gacttttagg aaatggctac gaacttgatg ccattgcttc ggttatcctg       780
     gggggaacca gcatctccgg cggcagcgga agtgttgttg gaacgttagt gggggccctg       840
     attattgcgg tgctgaataa cggacttacc cttatgaatg tctcctattt ttggcaattg       900
     gttgtacgtg gcatcgttat tattgttgcg gtattaatag aacgatttcg ccatcgaaaa       960
     aaagtctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page