(data stored in ACNUC7421 zone)

EMBL: CP002116.PE57

CP002116.PE57        Location/Qualifiers
FT   CDS_pept        62189..63106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0057"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011495:IPR005467; KEGG: lbf:LBF_2370
FT                   signal transduction histidine kinase; PFAM: histidine
FT                   kinase dimerisation/phosphoacceptor; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Putative two-component response
FT                   regulator; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79217"
FT                   /db_xref="GOA:E1R6T5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T5"
FT                   /protein_id="ADK79217.1"
FT                   /translation="MADNTVVILWFSIVFQLMAAAYALFLIRVTGLRYSWICISLALIL
FT                   MSVRRIVSLSSGLLGAATMGEPLYEAIGLLLSMLVFVGIVGIRSILVEWRKNQTKVEAL
FT                   LQEKEMILREVHHRIKNNMSTILSFLSLQAETLGSSPARTSIEEAENRVRSMMILYDKL
FT                   YRGENVDACPIDQYLPLLIDQILATFPNSDSVEVEKSIGNFELDAKRLSLVGIIVNELL
FT                   TNSMKYAFSDATRGHIRVHAELESGQVLIRFEDNGTGIPAHVDFEGTSDLGLRMIKALT
FT                   TQLDGTVQLEREEGTCISISFPFQ"
     atggctgata acaccgttgt cattttgtgg ttttctattg tgtttcaatt aatggcggct        60
     gcctatgcgc tatttctcat tcgagtgacc ggattacgat attcctggat ttgtatatct       120
     ctcgctttga ttctcatgag cgtccgacga atcgtttcgc tttcgagcgg gcttttaggg       180
     gccgctacga tgggggaacc cctatatgaa gcaattgggc ttttgctatc aatgctcgtt       240
     tttgtgggaa ttgtggggat tcgttctatc cttgtcgagt ggagaaagaa tcagactaag       300
     gtggaggcgc tccttcagga aaaagagatg atactgagag aggtgcacca taggatcaaa       360
     aataatatgt ccacgatact tagctttctt tcgcttcaag ccgaaacatt gggttcgtca       420
     ccggcaagaa cctcaatcga ggaggcggaa aatcgtgttc gaagcatgat gattttgtac       480
     gataaactgt acaggggcga gaatgtcgat gcttgtccta ttgatcaata tcttcccttg       540
     ctaatcgatc agattcttgc gacctttccc aatagtgatt cggtcgaggt tgagaagagt       600
     atcggaaatt ttgagctgga tgcaaaacgt ctttccttgg ttggaattat cgtcaacgaa       660
     cttttgacaa acagcatgaa atacgctttt tccgatgcga cacgtggaca tattcgtgtg       720
     catgcagagc tggaatccgg acaggtcttg attcgctttg aagacaacgg aacaggaatc       780
     cctgctcatg tcgattttga aggtacctcg gatttaggcc ttcgaatgat taaagcgctt       840
     accactcagc ttgacggtac cgttcaactg gaacgggaag agggaacctg catttcaata       900
     tccttcccgt ttcaatag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page