(data stored in ACNUC7421 zone)

EMBL: CP002116.PE58

CP002116.PE58        Location/Qualifiers
FT   CDS_pept        complement(63113..64912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0058"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR003660; KEGG: cbt:CLH_1795
FT                   methyl-accepting chemotaxis protein; PFAM: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; SPTR:
FT                   Methyl-accepting chemotaxis protein; PFAM: HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79218"
FT                   /db_xref="GOA:E1R6T6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T6"
FT                   /protein_id="ADK79218.1"
FT                   /translation="MNSSIQSIKWKLLGSFLLLILMFASIEIITFRGNQMNSQKIHDLK
FT                   NELLPETLSFLTIEKDVIQIQQWLTDISATRAAPGYDDGFNEAESYYNDAQERVDTFIQ
FT                   VYASKEENTAVDTLRTFKQDLDAFYDTGKAMAEAYINGGPSKGNPMMGEFDPVAERLSR
FT                   TMRDLVDSHTAGLNQAVVAIEANNGFVNRLTLLLMAAIILISALVAFLSIRTIHVGLLQ
FT                   VMQYAQNLSIGSFTLETEFHRKDEFGQLIRHFNEGFATVRSLIVSVKESADASSAVNTT
FT                   LRTSTDEVSASVTEIRANTESIGHHIERQTGLVSESSSAVEQIRTNIQDMTNQVEQQAG
FT                   AVIQSSAAVEEMAASIANVARISQNRQQEIPELISVIEQTDSNIESTGMVIDNVAALST
FT                   QMLEVIGVINNISTQTNLLAMNAAIEAAHAGEAGKGFSVVADEIRKLAEETSSNSKQIA
FT                   ETLGKVNAIIQEAQESAQENKTSFARLRLGVTNLANSFQEVSSTMGEINTGADEINIAI
FT                   NELTEITESIKSASSEINNGAGEIAESMDGLQGVSSEILLGIREISAGVQEVTGSMVTL
FT                   QELFSESVEAVDRIEDNLKRFSI"
     atgaatagtt cgatccagtc gataaaatgg aaattgcttg gaagtttttt acttcttatt        60
     ctcatgtttg ccagcataga aatcattacg tttcgcggta atcagatgaa cagtcagaaa       120
     atccatgatt taaaaaatga acttctccct gaaacactca gcttcctgac gattgagaaa       180
     gacgtaatac aaattcaaca atggcttaca gatatatcgg caacaagggc cgctcctggt       240
     tatgatgacg gctttaacga agcggaatcc tactataatg atgcacagga gagggtcgat       300
     acgtttatcc aagtctatgc atcaaaagaa gaaaacaccg cagtcgatac cctccgcacc       360
     tttaaacaag accttgatgc gttttacgat acaggcaaag caatggcgga ggcctacatc       420
     aatggggggc cctccaaagg aaatccgatg atgggcgaat ttgacccggt ggccgaacgt       480
     ctttcccgca ccatgcggga tctggtggac agccatacgg cgggtctaaa tcaagccgtt       540
     gtcgcaatcg aggccaataa tggctttgtt aatcgtctca ctcttctatt aatggccgcc       600
     atcatattga taagcgcgtt agtcgcattc ctatcgatta gaaccattca cgtggggctc       660
     ctacaggtca tgcagtatgc ccagaatctt tccatcggtt ccttcacttt ggaaaccgag       720
     ttccaccgaa aggatgagtt cggtcaactg atacgtcatt tcaatgaggg attcgcaacc       780
     gtcagatctc tcatcgtcag cgttaaggaa tccgcagatg caagttccgc ggtaaacacc       840
     acgctcagga cctccaccga cgaagtatcg gcatcggtta cggaaatacg tgccaacacc       900
     gaatcaatcg gacaccatat agaacggcaa accggactgg tttcagaatc gagtagcgcc       960
     gtcgaacaga ttagaaccaa tattcaagat atgaccaacc aggtcgagca acaggccggt      1020
     gccgtcatcc aatcgtcggc cgccgttgag gagatggcag catccatagc aaatgttgcc      1080
     cgaatatcac aaaatcggca acaggaaatt cccgaactga tctccgttat tgaacaaacc      1140
     gacagcaaca tcgaatcaac tggcatggtc attgataatg ttgccgccct ctcaacacaa      1200
     atgcttgaag taatcggtgt catcaataat atttcaacgc agaccaatct tctagccatg      1260
     aatgctgcca ttgaggctgc tcatgcggga gaagcgggaa agggattttc cgttgtggcc      1320
     gatgagatca gaaaacttgc agaagaaaca tcgtccaatt ccaagcaaat tgccgaaaca      1380
     ttaggcaaag taaatgcgat catacaagag gcccaggaat cggcgcagga aaacaagacc      1440
     tcctttgccc ggctccgttt gggagttacc aatctagcca attcctttca ggaagtctcc      1500
     tccaccatgg gagaaatcaa taccggggcg gatgaaatca atatcgcaat aaatgagctt      1560
     acggaaataa cagaatccat caagtcagcc tcttcggaaa tcaataacgg tgcaggtgaa      1620
     attgcagaat cgatggatgg cctacaggga gtaagcagtg agatccttct gggaatcagg      1680
     gagattagcg cgggtgttca agaggttacc ggttcgatgg tcacattaca ggaactcttt      1740
     tcagaatctg tcgaggccgt agataggatc gaagataacc tgaaacgttt ttccatttga      1800
//

If you have problems or comments...

PBIL Back to PBIL home page