(data stored in ACNUC7421 zone)

EMBL: CP002116.PE59

CP002116.PE59        Location/Qualifiers
FT   CDS_pept        65000..66766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0059"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COGs: COG0469 Pyruvate kinase; InterPro
FT                   IPR015793:IPR001697:IPR015794:IPR018209; KEGG: pth:PTH_2214
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PRIAM: Pyruvate kinase; SPTR: Pyruvate
FT                   kinase; TIGRFAM: pyruvate kinase; PFAM: Pyruvate kinase,
FT                   barrel domain; Pyruvate kinase, alpha/beta domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79219"
FT                   /db_xref="GOA:E1R6T7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T7"
FT                   /protein_id="ADK79219.1"
FT                   /translation="MKYLRKTRIVATIGPACDDLAIQKELLKAGVNVARFNFSHGNHEE
FT                   QAKRIASMRRASEETSVPVALMMDTKGPEIRTGNVKGEAELALHSGFEIVLTSRHVEGT
FT                   REELSVSYQNLPSEVEAGDHIFIADGVIDLEVLAVSGPDIRCLIRNGGMLGSKKNVNVP
FT                   GVKVGLPAITEKDREDIRFAVEHQMDYIAASFIRRPEDVEEIREILKQYHSSIRIIAKI
FT                   ENQEGLDNIDDIIRISDGVMVARGDLGVQLSTEQIPLAQKRIIGKCMRQGKPVITATQM
FT                   LDSMIHNPSPTRAELTDVANAIFDGTDAVMLSGETAGGAFPVRSVETMGRIAEAVETSE
FT                   EYRRRCTQWFETVQRPKDIGHTIARAAYVVASDIDASAIVAPTLRGNTPRILSNYRPNQ
FT                   LIIAVTTSEESYRQLLLHWGIFPILSAPVKDSDMMIQNALRLAREHGYVAPPDRVVTTA
FT                   GIPLNSPQPLNTIKIHFLGTILNRGHAGMGDRCSGALVKAENFELAQHRLRWDGTEILL
FT                   TGSIGKELFPRLSSLRGIVIEGELSLSPEEVRKIASKIVIIADVPNAMDNFEDGQLVTL
FT                   DGKEKIIYEGFM"
     ttgaaatacc taagaaagac cagaattgtg gcgacgatag gtcctgcctg tgatgatctt        60
     gcgatacaga aggaacttct caaagcgggg gtaaatgttg ccaggttcaa tttttctcat       120
     ggtaatcacg aggagcaagc caaacggata gcatcgatga ggcgtgcttc ggaggagact       180
     tctgttcccg ttgccctgat gatggatacg aagggaccgg aaatccggac tgggaatgtc       240
     aagggcgaag ctgagcttgc cttacacagc ggctttgaaa tcgtattgac ctcccgtcac       300
     gttgagggga ccagagaaga gctgtcggtg agttatcaga atctaccctc cgaggtcgag       360
     gctggggatc atatttttat tgcagatggg gttatcgatt tggaagtcct tgcggtctca       420
     ggtcctgata ttcgttgttt gattcgtaac ggcggaatgc ttggcagcaa gaaaaacgtg       480
     aatgttcctg gcgtaaaggt tggtttgccg gctatcacgg agaaagaccg tgaggacatt       540
     cgttttgcgg tcgagcatca gatggactac attgcagcca gttttatcag aaggcctgaa       600
     gatgttgaag aaattcgtga gattctcaaa caataccatt cttctatccg tatcattgca       660
     aagatagaga accaggaagg ccttgataat attgacgaca tcattcggat ttccgacgga       720
     gtgatggttg caagagggga tcttggggta cagctttcaa cggaacaaat tcctctggcc       780
     cagaaacgga tcattggaaa gtgcatgagg caagggaagc ccgttattac cgccacccag       840
     atgcttgatt ctatgattca caatccgagc cctaccaggg cagaattaac cgatgttgca       900
     aacgctattt ttgacggaac cgatgctgtc atgctttctg gcgagacagc aggcggtgcg       960
     tttcctgtac ggtcggttga aaccatggga cgcattgccg aggctgtcga aacgagtgag      1020
     gagtatcgac ggcggtgcac ccaatggttt gaaaccgtac aacgtccgaa agatataggt      1080
     cataccattg cacgggccgc ttatgttgtt gcatccgata ttgatgcttc cgcaattgtc      1140
     gctccgacgc ttcggggaaa tactcctcga attctgagca actatcgacc gaaccagctc      1200
     attattgccg tcaccacctc tgaggaaagc tatcgtcagc ttcttcttca ttggggaatt      1260
     tttccgattt tatctgctcc ggtgaaagat tccgacatga tgatccagaa tgccttgagg      1320
     cttgcacgtg agcatgggta tgtggcccct cctgatcgtg tggttaccac ggcggggatt      1380
     cctcttaact ctcctcaacc cctcaatacg atcaagatcc attttcttgg gacgatccta      1440
     aatagaggtc atgccggtat gggggatcgc tgttccgggg ctcttgttaa ggctgaaaat      1500
     tttgaacttg cccagcatcg tcttcgctgg gatggaaccg agattttgtt gaccggctcc      1560
     atagggaaag agcttttccc tcgcctttcc tctttgcgag gaattgttat agagggggag      1620
     ctttccctat ctcccgagga ggttcgcaag atcgcttcta agattgtaat catagccgat      1680
     gtccctaacg ccatggacaa ttttgaggat gggcagctgg tgactcttga tggcaaagag      1740
     aagatcattt acgaaggctt tatgtga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page