(data stored in ACNUC7421 zone)

EMBL: CP002116.PE62

CP002116.PE62        Location/Qualifiers
FT   CDS_pept        68033..69451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0062"
FT                   /product="FeS assembly protein SufB"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR010231:IPR000825; KEGG: ttr:Tter_1698 FeS assembly
FT                   protein SufB; PFAM: SufBD protein; SPTR: FeS assembly
FT                   protein SufB; TIGRFAM: FeS assembly protein SufB; PFAM:
FT                   Uncharacterized protein family (UPF0051); TIGRFAM: FeS
FT                   assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79222"
FT                   /db_xref="GOA:E1R6U0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U0"
FT                   /protein_id="ADK79222.1"
FT                   /translation="MSETNTMEAVAGIGDDAYKLGFHYPEHSIIKTKKGLSEEVVREIS
FT                   AAKGEAAWMLEFRLAALETFRKMPMPGWGSDLSGIDFDDYYYYAKPVNEQSGSWEELPQ
FT                   DIRDTYERLGIPEAERRFLGGVGAQYDSEMVYHKIRKDFESKGILFMDTETGEREHEEL
FT                   FRKYFASVVPSTDNKFAALNAAVWSGGSFVYVPKGVKVDIPLQAYFRINTKSLAQFERT
FT                   LIVVDEGAFVHYIEGCTAPIYAKDSLHTGVVEIVALPGARVRYSTIQNWSTNVYNLVTQ
FT                   RAKAHAGASVEWVDGNIGSKSTMKYPCVVLAGEGAHGEVLSIAFAGRGQEQDAGGKMIH
FT                   LANNTSSVITSKSISKDGGISSYRGLVKVAPHLRGVKSKVECDALILDEKSTSNTYPTM
FT                   DIQTDDVRMEHEAKVSKISEEELFYLQSRGIDEEEAAKMIVAGFIDPLVRELPMEYAVE
FT                   LNRLIDLEMEGAVG"
     atgtctgaaa cgaacaccat ggaagcggta gcgggcatag gtgatgatgc ctacaaatta        60
     ggctttcatt atcctgagca ctccatcatc aagacaaaaa aagggctttc cgaggaggtg       120
     gtacgagaga tttcggctgc taaaggggag gctgcctgga tgctcgaatt tcgacttgct       180
     gctttggaaa cttttcgcaa gatgcccatg cccggctggg gttcagacct ctcgggaata       240
     gatttcgacg attactacta ttatgccaaa ccagtgaatg agcaaagcgg ctcttgggaa       300
     gagctccccc aggatatccg tgacacctac gaacgattgg gaatcccgga ggcggagcgc       360
     cgatttttag gcggggtggg cgcccagtat gattccgaga tggtgtatca caagatccgg       420
     aaagattttg aatcaaaggg cattcttttt atggataccg aaacaggaga gcgcgaacac       480
     gaagagcttt ttcgtaagta ttttgcctcc gttgtccctt cgactgacaa taaatttgcg       540
     gccctcaacg ctgccgtctg gtccggcggt tcctttgtct atgtgcccaa aggggtaaag       600
     gttgatatcc cccttcaggc ttacttccgt atcaatacca aaagcctggc gcagttcgaa       660
     cgtactctga tcgtggtgga tgagggggcc ttcgttcact atatcgaggg ctgtaccgca       720
     cctatatatg caaaggactc cctccatacc ggggtggttg agatcgtcgc cctccccggg       780
     gcaagggtgc gatattcgac catacaaaac tggtcgacca atgtatacaa cttggttacc       840
     cagcgtgcta aggctcatgc gggagcctcc gtcgaatggg tagatggtaa catcggttcg       900
     aaaagcacca tgaagtaccc ctgcgttgtc cttgcgggag aaggggccca cggagaggtc       960
     ctttcgattg cctttgccgg ccggggccag gaacaggatg ccggcggcaa gatgattcac      1020
     ctggcgaata acacctccag cgtcatcact tccaagtcca tcagtaagga tggcggaatc      1080
     tccagttatc gtggacttgt aaaggttgcc ccgcatctgc gtggtgtgaa aagtaaggtt      1140
     gagtgtgatg ccctcatcct ggatgaaaaa tctacaagca atacctatcc tacaatggat      1200
     attcagactg acgatgtacg gatggagcat gaggcaaagg tgtcgaaaat atcagaggaa      1260
     gaacttttct accttcagag ccggggaata gatgaggaag aggccgctaa aatgattgta      1320
     gccggcttca tcgatcctct tgttcgggag ctccccatgg aatatgcggt agagcttaat      1380
     cgtctcatcg atcttgagat ggaaggagcg gtaggataa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page