(data stored in ACNUC7421 zone)

EMBL: CP002116.PE63

CP002116.PE63        Location/Qualifiers
FT   CDS_pept        69451..70740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0063"
FT                   /product="SufBD protein"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR000825; KEGG: acr:Acry_2270 FeS assembly protein SufD;
FT                   PFAM: SufBD protein; SPTR: FeS assembly protein SufD; PFAM:
FT                   Uncharacterized protein family (UPF0051)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79223"
FT                   /db_xref="GOA:E1R6U1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U1"
FT                   /protein_id="ADK79223.1"
FT                   /translation="MNERTMEATRLSWLSEHKNKADAAWKQLPWPGRKNPQWKNSPVSL
FT                   FEAETFTAEQDWEEHAWDTADTSSGPQVTASGAIDDDRYAAVLRFVDGKPDFDKQTIES
FT                   RGIELSFGAAPEWGARFLEAADLSDKLHARLFAEAAPVMSLSIAPGVNLAGPILLDWVD
FT                   GRPDFYAAPLFFLKIGEAAQLRLTLCWRTPDGRKTRLFLSPALFVDLERNARLDLFELE
FT                   HLSHRARFLDYPVAILEEKAELRWSRGIFGVGVSKSTILARLEGRASRFDFAAAYASPD
FT                   KSHVDISVTQRHIAPFTWSRSRLDAVADGSGKAISHGLIEVKESGIGTDAYLSTKTLSL
FT                   SPHAKAVSLPELAIDTNDLTASHGSTVGTISPEELFYLASRGIEIGEAKALIAEGVLGL
FT                   ILERTPSELTDTLESLIEDALETESEVARG"
     atgaacgaaa ggacgatgga ggctacccgg ctttcctggc tgagcgagca caaaaacaaa        60
     gcggatgctg cctggaagca gcttccctgg ccgggaagaa agaaccccca gtggaagaat       120
     agcccggtct cgctttttga ggcggaaacc tttactgcag aacaggattg ggaagagcat       180
     gcctgggata ccgctgatac ctcttctggc ccgcaggtca cagcgtccgg tgctattgat       240
     gatgaccgct atgctgctgt ccttcgtttt gtggacggca aacccgactt tgataagcaa       300
     accatagaaa gccggggaat tgaactctct tttggagcgg cccccgagtg gggcgcccgt       360
     tttctagaag ccgctgatct gtcggacaaa ctccatgccc ggctctttgc cgaagcggca       420
     ccggtaatga gcctttcgat agcacctggc gtgaatcttg caggtccaat ccttttggat       480
     tgggtggatg gtcggcccga tttctatgcg gctcctcttt tttttctgaa gataggggag       540
     gcggcacagc ttcgccttac cctgtgctgg cgtactcccg acggccgaaa aacgcgtctt       600
     tttctctctc ccgctctttt tgtcgatctt gaacgaaacg cccgtctgga cctttttgag       660
     cttgagcacc tcagtcacag ggctcgattc cttgactatc cggttgccat tttggaagag       720
     aaagcggaac tccgctggag ccgtggcatc tttggggttg gcgtgtcaaa gagtacaatt       780
     cttgcccgcc tggaggggcg ggcctcccgt ttcgattttg ccgcggctta tgcatctcca       840
     gacaagagcc atgttgatat ttcagtgaca cagcgtcata ttgcaccttt tacctggtcc       900
     cgttctcgcc tggatgccgt ggcggatgga agcggcaagg ctatttccca cggtctcatt       960
     gaggtgaagg agtccggtat cggtaccgat gcctatcttt ctacaaagac tctgagcctt      1020
     tctccacatg ccaaggcagt aagtttgccg gaacttgcga tcgatacgaa tgatctgact      1080
     gccagtcatg gttccactgt cggcaccatc agtcctgagg agcttttcta cctggccagt      1140
     cgtgggatcg agataggtga ggcaaaggcc cttatcgccg aaggtgttct cggccttatc      1200
     cttgaaagaa cgccttccga gctgaccgat accctggaat ctcttataga agatgctcta      1260
     gagaccgaat cggaggttgc tcgtggctaa                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page