(data stored in ACNUC7421 zone)

EMBL: CP002116.PE65

CP002116.PE65        Location/Qualifiers
FT   CDS_pept        72019..72483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0065"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; InterPro IPR011341:IPR002871; KEGG: sha:SH2036
FT                   hypothetical protein; PFAM: nitrogen-fixing NifU domain
FT                   protein; SPTR: SUF system FeS assembly protein, NifU
FT                   family; TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: NifU-like N terminal domain; TIGRFAM: SUF
FT                   system FeS assembly protein, NifU family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79225"
FT                   /db_xref="GOA:E1R6U3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U3"
FT                   /protein_id="ADK79225.1"
FT                   /translation="MSTIEREVDREIIYDHYTRPRHFGALGPDAVMLENPSCGDTVRLS
FT                   IRGGISSDGSEPLEFRFEGKGCSISQSSTSMMVELLSGKSRGEAIRIAERVLSVFRGER
FT                   DPHVLEDLGDISALAGIARLPVRVKCAALAWQGALKLLRQQERAYSEVDR"
     atgagcacta ttgaaagaga ggtcgatcgc gagattatct acgatcacta tacgcggcca        60
     cggcactttg gtgccctcgg tccggatgct gtcatgctgg aaaatccttc atgtggtgat       120
     accgtacgtc tcagtatacg tggtgggatt tcgtccgatg gctcagagcc tctggaattc       180
     cggtttgagg gaaaaggatg ttccatcagt cagtcgtcca cctccatgat ggtcgaactg       240
     ctttcgggta agagccgcgg agaggccatt cgcatagcgg aacgtgtgct ctcggtcttt       300
     cggggagagc gtgatcccca tgttttggaa gatttggggg atatctctgc gcttgccggg       360
     attgcccgcc ttcctgttcg cgtaaagtgt gcggccctgg cctggcaggg ggctcttaag       420
     cttttgcggc agcaagagcg agcgtattcg gaagtagatc gatag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page