(data stored in ACNUC7421 zone)

EMBL: CP002116.PE66

CP002116.PE66        Location/Qualifiers
FT   CDS_pept        complement(72493..73500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0066"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: oan:Oant_4373 regulatory protein
FT                   LacI; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; SPTR: Regulatory protein LacI; PFAM:
FT                   Bacterial regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79226"
FT                   /db_xref="GOA:E1R6U4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U4"
FT                   /protein_id="ADK79226.1"
FT                   /translation="MKVTLKDIANYAEVSSATVSLVLNNKGNISPETRDRVLKAIRHFD
FT                   YNKSHGPASQQRTIKFLKIAKHGQVINRDHDVFIADYLDGLTSGAQELDYKLEVVSFAH
FT                   TSVADIIASALQEPSISGAIVLATELNRDDMLLFSTTTIPIVFIDTYNEYLPFDFVDMD
FT                   NKSSIYKAFIYLKELGFPEIGFVASYSDISNFRIRENAYKESISYYPDMNPDIISVEST
FT                   FHGAYRDMNAYLEEHKKLTHKAYICSNDIMALGTIKALKEHGFRIPEDVSLLGFDNLPQ
FT                   SAQADPPLSTIEVSKRDIASIAVKQLHNRIEAPGSPTVRSLVGGALILRESIRR"
     gtgaaagtaa cactgaaaga tattgcaaat tatgccgagg tttccagtgc cacggtctcg        60
     cttgttctca acaacaaggg aaacatcagt ccggagacca gagaccgtgt actgaaagcg       120
     atacgccatt ttgattacaa taagagccat ggcccggcat cacagcaacg gaccataaaa       180
     ttcttaaaga ttgccaaaca tggccaggtc atcaaccgcg atcacgatgt gttcattgcc       240
     gactatctcg acggcctcac ttcgggggca caggaacttg actacaaact tgaggtggtt       300
     tcctttgccc atacctctgt agccgatatc atcgccagcg cactgcagga accatcaatt       360
     tcaggggcaa ttgttcttgc cacggaatta aaccgggatg atatgctgct tttttccacc       420
     actaccattc ctatagtctt catcgatacc tacaacgaat atctaccctt tgattttgtg       480
     gatatggata acaagagttc tatctataag gcttttatct atctaaaaga gctcgggttt       540
     ccggaaatcg gttttgtcgc cagttattcc gatatctcaa actttagaat tcgtgaaaac       600
     gcatataaag aaagcatttc gtattatccg gacatgaatc cggatattat ttccgtcgaa       660
     tcaacctttc acggagcgta tcgcgatatg aacgcttacc tggaagaaca taaaaaactt       720
     acgcataaag cctatatttg ttccaacgat atcatggccc ttggcacgat aaaagcgctc       780
     aaagagcacg gttttagaat tccggaagat gtatcgctgc tgggtttcga caatctccct       840
     cagtctgccc aggccgatcc ccctctttcc accatagagg tatcgaaacg ggatatcgcc       900
     agcatagccg tcaaacagct tcacaaccgc attgaggcac ccggaagccc cacggttcgc       960
     tcgcttgtag gcggcgcctt gattctccgg gaaagtatca ggcgctaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page