(data stored in ACNUC7421 zone)

EMBL: CP002116.PE68

CP002116.PE68        Location/Qualifiers
FT   CDS_pept        74694..75659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: bcl:ABC3606 hypothetical protein;
FT                   PFAM: conserved hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Tripartite tricarboxylate
FT                   transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79228"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U6"
FT                   /protein_id="ADK79228.1"
FT                   /translation="MKKKITMVLIALLAVGTLCFANGQSEGQPFPAKEVTIVVPYSPGG
FT                   ASDTVTRIIAKNTESALGVPVIVTNKTGASGSIGMDYVRKSTPDGYTISYMPVESTMVS
FT                   ALGYTDLAPADFDFVAGAMTLSAALTVRADAPWDSVEEFLAYAKANPGKLNIGNSGTGS
FT                   IWHIAAASIEESQGVQFNHVPFEGAAPAIAALLGGHIDAITVSDAEVLPNVKNGDFKVL
FT                   AVMGNERSATLPEVPTLKDLGIDVAVFGWGGFAVPKGTPDDVKAILGAAFKVGIGSADF
FT                   AQLCKERGFTQKYMTGKEIQEFAQEQYEYYSKLIPKLGIH"
     atgaagaaaa agatcactat ggtactgatc gctttgctgg cggtcggtac cctctgtttt        60
     gccaacggcc agtccgaagg ccagcctttt ccggccaagg aagtaaccat tgtcgttccc       120
     tattctccag gtggcgcttc cgataccgta acccgtatca ttgcaaagaa taccgaatct       180
     gcattgggcg ttcccgtaat cgtcaccaac aagaccggtg cttccggttc cattggtatg       240
     gactatgtga gaaaaagcac acctgacgga tataccatct cctacatgcc cgttgaatcc       300
     accatggtaa gtgctcttgg ctataccgat ctcgctcccg cagattttga ttttgttgca       360
     ggtgccatga ccctttccgc cgcccttacc gttcgtgcgg acgctccctg ggacagtgtc       420
     gaggagtttc ttgcatatgc aaaagcgaac cccggcaagc tgaatatcgg taactcaggc       480
     accggatcta tctggcacat cgcagccgcc tcgatcgagg agtcgcaagg cgttcaattc       540
     aaccacgttc cttttgaagg tgcggctcct gccattgccg ccctcctcgg cggacacatc       600
     gatgccataa cggtaagtga tgcagaagtt cttcctaatg taaagaacgg ggactttaag       660
     gtccttgccg tgatgggaaa tgaacgatcc gctacacttc cagaggttcc caccctcaaa       720
     gatctgggaa tcgatgtcgc cgtattcggt tggggtggtt ttgccgttcc caagggaacc       780
     cccgacgatg tcaaggcgat tctcggcgcc gctttcaagg ttggtatagg atctgctgat       840
     tttgcccagc tgtgtaaaga acgaggcttt acccagaaat atatgaccgg caaggaaatt       900
     caggaattcg cacaggaaca gtatgaatac tattccaagc tgatccccaa actgggaatt       960
     cactaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page