(data stored in ACNUC7421 zone)

EMBL: CP002116.PE69

CP002116.PE69        Location/Qualifiers
FT   CDS_pept        75729..76175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tle:Tlet_0634 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79229"
FT                   /db_xref="GOA:E1R6U7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U7"
FT                   /protein_id="ADK79229.1"
FT                   /translation="MLYGDLVFGAVSLGLSVWFFIMSLGFPSGSSSNGVPGAGFFPGVI
FT                   SILIALVSIVLMVQGFRQKRHYFQPVKSIKEMPTNTRNLFLTIVSLMIFMLLWKFVHFF
FT                   VAIGAFIFFLNVLFRQKLLVNIIYTVVSIAFIYLTFGKIFHVMF"
     atgttgtatg gagatcttgt cttcggggcc gtatctctgg gcttgagcgt ttggtttttc        60
     attatgagtc tcggctttcc gtcgggttcc tcgtccaatg gtgtccccgg tgccggtttt       120
     tttcccggag ttatttctat cctcattgcc cttgtttcga ttgttttaat ggttcaaggg       180
     tttcgacaaa aacgacacta ttttcaaccg gtcaaatcga taaaggagat gccgacaaac       240
     accaggaatc tttttcttac gatagtttct ttgatgattt ttatgcttct ctggaagttt       300
     gtacattttt ttgttgctat tggggccttt atttttttcc ttaatgtact gtttcgccaa       360
     aaactccttg tcaacatcat ctacacggtg gtcagcatcg catttatcta tttgacgttc       420
     ggaaaaattt ttcacgtcat gttctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page