(data stored in ACNUC7421 zone)

EMBL: CP002116.PE7

CP002116.PE7         Location/Qualifiers
FT   CDS_pept        4683..5030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0007"
FT                   /product="ribonuclease P protein component"
FT                   /note="InterPro IPR000100:IPR020539; KEGG: tde:TDE2399
FT                   ribonuclease P protein component; PFAM: ribonuclease P
FT                   protein; SPTR: Ribonuclease P protein component; TIGRFAM:
FT                   ribonuclease P protein component; manually curated; PFAM:
FT                   Ribonuclease P; TIGRFAM: ribonuclease P protein component,
FT                   eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79167"
FT                   /db_xref="GOA:E1R6N5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N5"
FT                   /protein_id="ADK79167.1"
FT                   /translation="MKHSADIGRVFSSRTRVSCLGAKLMYRTNNTERNRFTVTLVRKYG
FT                   NAVQRNRAKRVAREAYRLIKPEIRQGYDMVLLLYRSEDTLSNRSRQLSDLLHKAQLLGK
FT                   RHPLFLSIKDQ"
     ttgaaacact cggccgacat cggccgagtg ttctcttcac gaaccagggt gtcctgcctt        60
     ggcgcgaaac tgatgtatcg aacaaataat acagaaagga accgttttac ggttaccctg       120
     gttagaaagt atggaaatgc cgttcagaga aaccgggcaa agagagtagc ccgggaggct       180
     tatcggctca ttaagcctga aatccgacag ggatatgaca tggtcttgct tttgtatcga       240
     tctgaagata cattgtccaa tcgtagccgt caattgagcg atttattaca caaggcacaa       300
     cttcttggaa agcggcatcc gctttttctc tcaatcaagg accagtag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page