(data stored in ACNUC7421 zone)

EMBL: CP002116.PE70

CP002116.PE70        Location/Qualifiers
FT   CDS_pept        76198..77709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0070"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: bcl:ABC3604 hypothetical protein;
FT                   PFAM: protein of unknown function DUF112 transmembrane;
FT                   SPTR: Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79230"
FT                   /db_xref="GOA:E1R6U8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U8"
FT                   /protein_id="ADK79230.1"
FT                   /translation="MGIWLHVLQSLLNPGVLLYLLFGVVIGSFLGGLPGLTATMGIAIL
FT                   TPITFWFSPEKGFAMLIGVWNSAIWAGGLTAILVNTPGTPASIATTFDGFALTKLGKAK
FT                   LALQINTVFSVFGGLFSTLILIVAAFPLAKLAIKFGPAEYFMLGLFGLTMMISVSGNSL
FT                   TKGALMGFAGLLVSTIGLDPILAAKRFTFGITDLLMGVSFIPVMIGMFGVGEVLYQISV
FT                   SKSDDFIERDENASDKPIDLGKDHLTLKMIWEMGPLAFLMAAVATVVGAIPAAGGDIAS
FT                   IICWGQAKRLSRHPEKYGKGSEEGLATSCIANNGVLGGALTTMLTLGIPGDAATAIMIG
FT                   SLMMYGMQPGPRMFVENKEFVITIMLLMIFANIIILLYGLLTTKASIKLLSVKKQFIWV
FT                   TVLILCIVGSFALNNSMFDVVVMLIAGFLGFFMKRMDYAPGPFILGLLLGKIIESNLRR
FT                   ALSLTQGSYSFLLTHPIVIVLEVLIILALIGPLVKKLRNGRKAVA"
     atgggtatat ggttacacgt gctgcaatcg cttctcaatc ccggtgtgct tctctatttg        60
     cttttcgggg tggtaatcgg gagttttctc ggggggcttc cgggcttaac tgcaaccatg       120
     gggattgcga ttcttacccc aattacattt tggttcagcc cggagaaggg atttgcaatg       180
     cttatcgggg tttggaactc ggccatctgg gccggaggac ttaccgcgat attggtcaat       240
     acaccgggaa ctcccgcatc gattgccacc acttttgatg gttttgccct gacgaagctg       300
     ggaaaggcca aacttgcttt gcagatcaat acggttttct ctgtgttcgg gggacttttc       360
     agtacgctga ttttgattgt tgcggccttt ccccttgcta aactggccat caagtttggg       420
     ccggccgaat acttcatgct ggggcttttc ggtcttacca tgatgatttc agtctcggga       480
     aactccttaa caaaaggcgc cttgatgggc tttgccggac tactggtttc caccatcggt       540
     cttgacccta tcctggcagc aaagcgcttt acattcggta tcaccgattt gctgatgggc       600
     gtctcgttca tccccgtaat gatcggcatg tttggtgttg gggaagtgct gtatcagatt       660
     tctgtttcca aaagcgatga ttttatcgaa cgggatgaga acgcttctga caagcctatc       720
     gatttgggaa aagatcattt aactctgaag atgatctggg agatggggcc gcttgctttt       780
     ctgatggcgg cggttgccac ggtcgttggt gctattccag ctgcgggagg ggatatcgca       840
     tcaattattt gctggggcca ggcaaaacgc ttatcacggc atccggaaaa atacggaaaa       900
     ggatcggaag aggggcttgc cacaagttgt attgccaaca acggtgtact tggtggtgcc       960
     ctgacgacca tgttgaccct tgggattccg ggggatgctg caaccgccat catgatcggt      1020
     tcgctcatga tgtacgggat gcagcctgga ccgcgaatgt tcgtggagaa caaggagttc      1080
     gtcattacca tcatgctgct gatgattttt gccaatatca tcatattgct gtatggtctg      1140
     cttaccacca aggcctctat caaacttttg tctgtgaaaa aacagtttat ctgggtgacg      1200
     gttctgattc tttgtattgt cggctccttt gccctgaata attcgatgtt tgatgtcgtt      1260
     gtcatgctga ttgcgggttt cctcgggttt tttatgaagc ggatggatta tgcgccgggt      1320
     ccctttattc tcggactgct gctcgggaaa attatcgaat cgaatctgcg tcgagcgctc      1380
     tcgttgacac agggaagtta cagtttcctt ctgactcatc ccatcgtcat tgttcttgag      1440
     gtgttgatca tacttgcact gattgggcct ctcgtaaaaa aactacgcaa tggccgaaag      1500
     gctgttgcct ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page